Human TFAP2A/AP-2/AP-2alpha ORF/cDNA clone-Adenovirus particle (BC017754)

Cat. No.: vGMAP000421

Pre-made Human TFAP2A/AP-2/AP-2alpha Adenovirus for TFAP2A overexpression in-vitro and in-vivo. The TFAP2A adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TFAP2A-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TFAP2A/AP-2/TFAP2A/AP-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000421 Human TFAP2A Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000421
Gene Name TFAP2A
Accession Number BC017754
Gene ID 7020
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1296 bp
Gene Alias AP-2,AP-2alpha
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGTTAGTTCACAGTTTTTCAGCCATGGACCGTCACGACGGCACCAGCAACGGGACGGCACGGTTGCCCCAGCTGGGCACTGTAGGTCAATCTCCCTACACGAGCGCCCCGCCGCTGTCCCACACCCCCAATGCCGACTTCCAGCCCCCATACTTCCCCCCACCCTACCAGCCTATCTACCCCCAGTCGCAAGATCCTTACTCCCACGTCAACGACCCCTACAGCCTGAACCCCCTGCACGCCCAGCCGCAGCCGCAGCACCCAGGCTGGCCCGGCCAGAGGCAGAGCCAGGAGTCTGGGCTCCTGCACACGCACCGGGGGCTGCCTCACCAGCTGTCGGGCCTGGATCCTCGCAGGGACTACAGGCGGCACGAGGACCTCCTGCACGGCCCACACGCGCTCAGCTCAGGACTCGGAGACCTCTCGATCCACTCCTTACCTCACGCCATCGAGGAGGTCCCGCATGTAGAAGACCCGGGTATTAACATCCCAGATCAAACTGTAATTAAGAAAGGCCCCGTGTCCCTGTCCAAGTCCAACAGCAATGCCGTCTCCGCCATCCCTATTAACAAGGACAACCTCTTCGGCGGCGTGGTGAACCCCAACGAAGTCTTCTGTTCAGTTCCGGGTCGCCTCTCGCTCCTCAGCTCCACCTCGAAGTACAAGGTCACGGTGGCGGAAGTGCAGCGGCGGCTCTCACCACCCGAGTGTCTCAACGCGTCGCTGCTGGGCGGAGTGCTCCGGAGGGCGAAGTCTAAAAATGGAGGAAGATCTTTAAGAGAAAAACTGGACAAAATAGGATTAAATCTGCCTGCAGGGAGACGTAAAGCTGCCAACGTTACCCTGCTCACATCACTAGTAGAGGGAGAAGCTGTCCACCTAGCCAGGGACTTTGGGTACGTGTGCGAAACCGAATTTCCTGCCAAAGCAGTAGCTGAATTTCTCAACCGACAACATTCCGATCCCAATGAGCAAGTGACAAGAAAAAACATGCTCCTGGCTACAAAACAGATATGCAAAGAGTTCACCGACCTGCTGGCTCAGGACCGATCTCCCCTGGGGAACTCACGGCCCAACCCCATCCTGGAGCCCGGCATCCAGAGCTGCTTGACCCACTTCAACCTCATCTCCCACGGCTTCGGCAGCCCCGCGGTGTGTGCCGCGGTCACGGCCCTGCAGAACTATCTCACCGAGGCCCTCAAGGCCATGGACAAAATGTACCTCAGCAACAACCCCAATAGCCACACGGACAACAACGCCAAAAGCAGTGACAAAGAGGAGAAGCACAGAAAGTGA
ORF Protein Sequence MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T71317-Ab Anti-TFAP2A monoclonal antibody
    Target Antigen GM-Tg-g-T71317-Ag TFAP2A protein
    ORF Viral Vector pGMLV000890 Human TFAP2A Lentivirus plasmid
    ORF Viral Vector pGMLV001091 Human TFAP2A Lentivirus plasmid
    ORF Viral Vector pGMAP000248 Human TFAP2A Adenovirus plasmid
    ORF Viral Vector pGMAP000421 Human TFAP2A Adenovirus plasmid
    ORF Viral Vector pGMPC000285 Human TFAP2A Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001244 Human TFAP2A Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000890 Human TFAP2A Lentivirus particle
    ORF Viral Vector vGMLV001091 Human TFAP2A Lentivirus particle
    ORF Viral Vector vGMAP000248 Human TFAP2A Adenovirus particle
    ORF Viral Vector vGMAP000421 Human TFAP2A Adenovirus particle


    Target information

    Target ID GM-T71317
    Target Name TFAP2A/AP-2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7020
    Gene ID 100063009 (Equus caballus), 101096393 (Felis catus), 21418 (Mus musculus), 306862 (Rattus norvegicus)
    488213 (Canis lupus familiaris), 505849 (Bos taurus), 700663 (Macaca mulatta), 7020 (Homo sapiens)
    Gene Symbols & Synonyms TFAP2A,Tfap2a,Ap2,AP-2,Ap2tf,Tcfap2a,AP2alpha,Ap-2 (a),BOFS,AP2TF,TFAP2,AP-2alpha
    Target Alternative Names AP-2,AP-2 transcription factor,AP-2alpha,AP2-alpha,AP2TF,AP2alpha,Activating enhancer-binding protein 2-alpha,Activator protein 2 (AP-2),Ap-2 (a),Ap2,Ap2tf,BOFS,TFAP2,TFAP2A,Tcfap2a,Tfap2a,Transcription factor AP-2-alpha
    Uniprot Accession A1A4R9,P05549,P34056,P58197
    Additional SwissProt Accessions: P34056,P58197,A1A4R9,P05549
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000017468, ENSMUSG00000021359, ENSCAFG00845019098, ENSBTAG00000001250, ENSMMUG00000006186, ENSG00000137203
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.