Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human RHOB/ARH6/ARHB ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_004040.4)
Cat. No.: pGMPC001834
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RHOB/ARH6/ARHB Non-Viral expression plasmid (overexpression vector) for mouse RHOB overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
RHOB/ARH6 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC001834 |
| Gene Name | RHOB |
| Accession Number | NM_004040.4 |
| Gene ID | 388 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 591 bp |
| Gene Alias | ARH6,ARHB,MST081,MSTP081,RHOH6 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCCATCCGCAAGAAGCTGGTGGTGGTGGGCGACGGCGCGTGTGGCAAGACGTGCCTGCTGATCGTGTTCAGTAAGGACGAGTTCCCCGAGGTGTACGTGCCCACCGTCTTCGAGAACTATGTGGCCGACATTGAGGTGGACGGCAAGCAGGTGGAGCTGGCGCTGTGGGACACGGCGGGCCAGGAGGACTACGACCGCCTGCGGCCGCTCTCCTACCCGGACACCGACGTCATTCTCATGTGCTTCTCGGTGGACAGCCCGGACTCGCTGGAGAACATCCCCGAGAAGTGGGTCCCCGAGGTGAAGCACTTCTGTCCCAATGTGCCCATCATCCTGGTGGCCAACAAAAAAGACCTGCGCAGCGACGAGCATGTCCGCACAGAGCTGGCCCGCATGAAGCAGGAACCCGTGCGCACGGATGACGGCCGCGCCATGGCCGTGCGCATCCAAGCCTACGACTACCTCGAGTGCTCTGCCAAGACCAAGGAAGGCGTGCGCGAGGTCTTCGAGACGGCCACGCGCGCCGCGCTGCAGAAGCGCTACGGCTCCCAGAACGGCTGCATCAACTGCTGCAAGGTGCTATGA |
| ORF Protein Sequence | MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T58361-Ab | Anti-RHOB monoclonal antibody |
| Target Antigen | GM-Tg-g-T58361-Ag | RHOB protein |
| ORF Viral Vector | pGMLP001028 | Human RHOB Lentivirus plasmid |
| ORF Viral Vector | pGMLP001841 | Human RHOB Lentivirus plasmid |
| ORF Viral Vector | pGMLP005661 | Human RHOB Lentivirus plasmid |
| ORF Viral Vector | pGMPC001834 | Human RHOB Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP001028 | Human RHOB Lentivirus particle |
| ORF Viral Vector | vGMLP001841 | Human RHOB Lentivirus particle |
| ORF Viral Vector | vGMLP005661 | Human RHOB Lentivirus particle |
Target information
| Target ID | GM-T58361 |
| Target Name | RHOB |
|
Gene Group Identifier （Target Gene ID in Homo species) |
388 |
| Gene ID |
100056328 (Equus caballus), 101099371 (Felis catus), 11852 (Mus musculus), 388 (Homo sapiens) 403670 (Canis lupus familiaris), 515118 (Bos taurus), 64373 (Rattus norvegicus), 702141 (Macaca mulatta) |
| Gene Symbols & Synonyms | RHOB,Rhob,Arh6,Arhb,ARH6,ARHB,RHOH6,MST081,MSTP081,RHO |
| Target Alternative Names | ARH6,ARHB,Arh6,Arhb,MST081,MSTP081,RHO,RHOB,RHOH6,Rho cDNA clone 6 (h6),Rho-related GTP-binding protein RhoB,Rhob |
| Uniprot Accession |
P62745,P62746,P62747,Q3ZBW5
Additional SwissProt Accessions: P62746,P62745,Q3ZBW5,P62747 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000051165, ENSMUSG00000054364, ENSG00000143878, ENSCAFG00845019784, ENSBTAG00000061681, ENSMMUG00000062968 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.