Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
Plasmid quantity:
- 10mg, 50mg, 100mg, 500mg, >1g
Talk to our Expert:
- • Research Grade
- • Endotoxin-Free Grade
- • High Quality (HQ) Grade
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected] -
Talk to our sales:
[email protected]
Protocol Library Download
 |
 |
Human IFI27/FAM14D/ISG12 ORF/cDNA clone-Lentivirus plasmid (NM_001130080.3)
Cat. No.: pGMLV001680
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IFI27/FAM14D/ISG12 Lentiviral expression plasmid for IFI27 lentivirus packaging, IFI27 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Datasheet
Go to
IFI27/FAM14D products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001680 |
| Gene Name | IFI27 |
| Accession Number | NM_001130080.3 |
| Gene ID | 3429 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 369 bp |
| Gene Alias | FAM14D,ISG12,ISG12A,P27 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGGCCTCTGCTCTCACCTCATCAGCAGTGACCAGTGTGGCCAAAGTGGTCAGGGTGGCCTCTGGCTCTGCCGTAGTTTTGCCCCTGGCCAGGATTGCTACAGTTGTGATTGGAGGAGTTGTGGCCATGGCGGCTGTGCCCATGGTGCTCAGTGCCATGGGCTTCACTGCGGCGGGAATCGCCTCGTCCTCCATAGCAGCCAAGATGATGTCCGCGGCGGCCATTGCCAATGGGGGTGGAGTTGCCTCGGGCAGCCTTGTGGCTACTCTGCAGTCACTGGGAGCAACTGGACTCTCCGGATTGACCAAGTTCATCCTGGGCTCCATTGGGTCTGCCATTGCGGCTGTCATTGCGAGGTTCTACTAG |
| ORF Protein Sequence | MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0997-Ab | Anti-IFI27 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0997-Ag | IFI27 protein |
| ORF Viral Vector | pGMLP000465 | Human IFI27 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001680 | Human IFI27 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000314 | Human IFI27 Adenovirus plasmid |
| ORF Viral Vector | pGMPC001580 | Human IFI27 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000465 | Human IFI27 Lentivirus particle |
| ORF Viral Vector | vGMLV001680 | Human IFI27 Lentivirus particle |
| ORF Viral Vector | vGMAP000314 | Human IFI27 Adenovirus particle |
Target information
| Target ID | GM-IP0997 |
| Target Name | IFI27 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
3429 |
| Gene ID | 170512 (Rattus norvegicus), 3429 (Homo sapiens), 700513 (Macaca mulatta) |
| Gene Symbols & Synonyms | Ifi27,IFI27,IRG1,Ifi27l,Ifi27l1,isg12(a),P27,ISG12,FAM14D,ISG12A |
| Target Alternative Names | IFI27,Interferon alpha-inducible protein 27, mitochondrial,p27,Interferon alpha-induced 11.5 kDa protein, Interferon-stimulated gene 12a protein (ISG12(a), ISG12A),P27,ISG12,FAM14D,ISG12A |
| Uniprot Accession |
P40305
Additional SwissProt Accessions: P40305 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | |
| Disease | Ovary Cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSG00000165949 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.