Human TFAP2A/AP-2/AP-2alpha ORF/cDNA clone-Lentivirus plasmid (NM_001372066.1)

Cat. No.: pGMLV001091
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TFAP2A/AP-2/AP-2alpha Lentiviral expression plasmid for TFAP2A lentivirus packaging, TFAP2A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TFAP2A/AP-2/TFAP2A/AP-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $669.6
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001091
Gene Name TFAP2A
Accession Number NM_001372066.1
Gene ID 7020
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1320 bp
Gene Alias AP-2,AP-2alpha,AP2TF,BOFS,TFAP2
Fluorescent Reporter Firefly luciferase
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAATGCTTTGGAAATTGACGGATAATATCAAGTACGAGGACTGCGAGGACCGTCACGACGGCACCAGCAACGGGACGGCACGGTTGCCCCAGCTGGGCACTGTAGGTCAATCTCCCTACACGAGCGCCCCGCCGCTGTCCCACACCCCCAATGCCGACTTCCAGCCCCCATACTTCCCCCCACCCTACCAGCCTATCTACCCCCAGTCGCAAGATCCTTACTCCCACGTCAACGACCCCTACAGCCTGAACCCCCTGCACGCCCAGCCGCAGCCGCAGCACCCAGGCTGGCCCGGCCAGAGGCAGAGCCAGGAGTCTGGGCTCCTGCACACGCACCGGGGGCTGCCTCACCAGCTGTCGGGCCTGGATCCTCGCAGGGACTACAGGCGGCACGAGGACCTCCTGCACGGCCCACACGCGCTCAGCTCAGGACTCGGAGACCTCTCGATCCACTCCTTACCTCACGCCATCGAGGAGGTCCCGCATGTAGAAGACCCGGGTATTAACATCCCAGATCAAACTGTAATTAAGAAAGGCCCCGTGTCCCTGTCCAAGTCCAACAGCAATGCCGTCTCCGCCATCCCTATTAACAAGGACAACCTCTTCGGCGGCGTGGTGAACCCCAACGAAGTCTTCTGTTCAGTTCCGGGTCGCCTCTCGCTCCTCAGCTCCACCTCGAAGTACAAGGTCACGGTGGCGGAAGTGCAGCGGCGGCTCTCACCACCCGAGTGTCTCAACGCGTCGCTGCTGGGCGGAGTGCTCCGGAGGGCGAAGTCTAAAAATGGAGGAAGATCTTTAAGAGAAAAACTGGACAAAATAGGATTAAATCTGCCTGCAGGGAGACGTAAAGCTGCCAACGTTACCCTGCTCACATCACTAGTAGAGGGAGAAGCTGTCCACCTAGCCAGGGACTTTGGGTACGTGTGCGAAACCGAATTTCCTGCCAAAGCAGTAGCTGAATTTCTCAACCGACAACATTCCGATCCCAATGAGCAAGTGACAAGAAAAAACATGCTCCTGGCTACAAAACAGATATGCAAAGAGTTCACCGACCTGCTGGCTCAGGACCGATCTCCCCTGGGGAACTCACGGCCCAACCCCATCCTGGAGCCCGGCATCCAGAGCTGCTTGACCCACTTCAACCTCATCTCCCACGGCTTCGGCAGCCCCGCGGTGTGTGCCGCGGTCACGGCCCTGCAGAACTATCTCACCGAGGCCCTCAAGGCCATGGACAAAATGTACCTCAGCAACAACCCCAACAGCCACACGGACAACAACGCCAAAAGCAGTGACAAAGAGGAGAAGCACAGAAAGTGA
ORF Protein Sequence MKMLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T71317-Ab Anti-TFAP2A monoclonal antibody
    Target Antigen GM-Tg-g-T71317-Ag TFAP2A protein
    ORF Viral Vector pGMLV000890 Human TFAP2A Lentivirus plasmid
    ORF Viral Vector pGMLV001091 Human TFAP2A Lentivirus plasmid
    ORF Viral Vector pGMAP000248 Human TFAP2A Adenovirus plasmid
    ORF Viral Vector pGMAP000421 Human TFAP2A Adenovirus plasmid
    ORF Viral Vector pGMPC000285 Human TFAP2A Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001244 Human TFAP2A Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000890 Human TFAP2A Lentivirus particle
    ORF Viral Vector vGMLV001091 Human TFAP2A Lentivirus particle
    ORF Viral Vector vGMAP000248 Human TFAP2A Adenovirus particle
    ORF Viral Vector vGMAP000421 Human TFAP2A Adenovirus particle


    Target information

    Target ID GM-T71317
    Target Name TFAP2A/AP-2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7020
    Gene ID 100063009 (Equus caballus), 101096393 (Felis catus), 21418 (Mus musculus), 306862 (Rattus norvegicus)
    488213 (Canis lupus familiaris), 505849 (Bos taurus), 700663 (Macaca mulatta), 7020 (Homo sapiens)
    Gene Symbols & Synonyms TFAP2A,Tfap2a,Ap2,AP-2,Ap2tf,Tcfap2a,AP2alpha,Ap-2 (a),BOFS,AP2TF,TFAP2,AP-2alpha
    Target Alternative Names AP-2,AP-2 transcription factor,AP-2alpha,AP2-alpha,AP2TF,AP2alpha,Activating enhancer-binding protein 2-alpha,Activator protein 2 (AP-2),Ap-2 (a),Ap2,Ap2tf,BOFS,TFAP2,TFAP2A,Tcfap2a,Tfap2a,Transcription factor AP-2-alpha
    Uniprot Accession A1A4R9,P05549,P34056,P58197
    Additional SwissProt Accessions: P34056,P58197,A1A4R9,P05549
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000017468, ENSMUSG00000021359, ENSCAFG00845019098, ENSBTAG00000001250, ENSMMUG00000006186, ENSG00000137203
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.