Human EIF4E/AUTS19/CBP ORF/cDNA clone-Lentivirus plasmid (NM_001130679.2)

Cat. No.: pGMLV000782
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EIF4E/AUTS19/CBP Lentiviral expression plasmid for EIF4E lentivirus packaging, EIF4E lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to EIF4E/AUTS19 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000782
Gene Name EIF4E
Accession Number NM_001130679.2
Gene ID 1977
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 747 bp
Gene Alias AUTS19,CBP,eIF-4E,EIF4E1,EIF4EL1,EIF4F
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGACTGTCGAACCGGAAACCACCCCTACTCCTAATCCCCCGACTACAGAAGAGGAGAAAACGGAATCTAATCAGGAGGTTGCTAACCCAGAACACTATATTAAACATCCCCTACAGAACAGATGGGCACTCTGGTTTTTTAAAAATGATAAAAGCAAAACTTGGCAAGCAAACCTGCGGCTGATCTCCAAGTTTGATACTGTTGAAGACTTTTGGGCTCTGTACAACCATATCCAGTTGTCTAGTAATTTAATGCCTGGCTGTGACTACTCACTTTTTAAGGATGGTATTGAGCCTATGTGGGAAGATGAGAAAAACAAACGGGGAGGACGATGGCTAATTACATTGAACAAACAGCAGAGACGAAGTGACCTCGATCGCTTTTGGCTAGAGACAAGATGGGATCTTGCTATGTTGCCCAGGTTGGTCTCAAACTTCTGGCCTCAAGTGATCCTCCCACTTCAGCCTCCCAAAGTGCTGGAATTACAGCTTCTGTGCCTTATTGGAGAATCTTTTGATGACTACAGTGATGATGTATGTGGCGCTGTTGTTAATGTTAGAGCTAAAGGTGATAAGATAGCAATATGGACTACTGAATGTGAAAACAGAGAAGCTGTTACACATATAGGGAGGGTATACAAGGAAAGGTTAGGACTTCCTCCAAAGATAGTGATTGGTTATCAGTCCCACGCAGACACAGCTACTAAGAGCGGCTCCACCACTAAAAATAGGTTTGTTGTTTAA
ORF Protein Sequence MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETRWDLAMLPRLVSNFWPQVILPLQPPKVLELQLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T31186-Ab Anti-EIF4E monoclonal antibody
    Target Antigen GM-Tg-g-T31186-Ag EIF4E protein
    ORF Viral Vector pGMLP004795 Human EIF4E Lentivirus plasmid
    ORF Viral Vector pGMLV000782 Human EIF4E Lentivirus plasmid
    ORF Viral Vector pGMLV001692 Human EIF4E Lentivirus plasmid
    ORF Viral Vector vGMLP004795 Human EIF4E Lentivirus particle
    ORF Viral Vector vGMLV000782 Human EIF4E Lentivirus particle
    ORF Viral Vector vGMLV001692 Human EIF4E Lentivirus particle


    Target information

    Target ID GM-T31186
    Target Name EIF4E
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1977
    Gene ID 100066216 (Equus caballus), 101080377 (Felis catus), 117045 (Rattus norvegicus), 13684 (Mus musculus)
    1977 (Homo sapiens), 281751 (Bos taurus), 487870 (Canis lupus familiaris), 706751 (Macaca mulatta)
    Gene Symbols & Synonyms EIF4E,Eif4e,If4e,eIF-4E,EG668879,Eif4e-ps,CBP,EIF4F,AUTS19,EIF4E1,EIF4EL1
    Target Alternative Names AUTS19,CBP,EG668879,EIF4E,EIF4E1,EIF4EL1,EIF4F,Eif4e,Eif4e-ps,Eukaryotic translation initiation factor 4E,If4e,eIF-4E,eIF-4F 25 kDa subunit,eIF4E,mRNA cap-binding protein
    Uniprot Accession P06730,P63073,P63074,Q9N0T5
    Additional SwissProt Accessions: P63074,P63073,P06730,Q9N0T5
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, HIF-1 signaling pathway, PI3K-Akt signaling pathway, Longevity regulating pathway
    Gene Ensembl ENSECAG00000006472, ENSMUSG00000028156, ENSG00000151247, ENSBTAG00000009522, ENSCAFG00845023892, ENSMMUG00000011066
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.