Human UBA52/CEP52/HUBCEP52 ORF/cDNA clone-Lentivirus plasmid (NM_001033930)

Cat. No.: pGMLP003398
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBA52/CEP52/HUBCEP52 Lentiviral expression plasmid for UBA52 lentivirus packaging, UBA52 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to UBA52/CEP52 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003398
Gene Name UBA52
Accession Number NM_001033930
Gene ID 7311
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 387 bp
Gene Alias CEP52,HUBCEP52,L40,RPL40
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGATCTTTGTGAAGACCCTCACTGGCAAAACCATCACCCTTGAGGTCGAGCCCAGTGACACCATTGAGAATGTCAAAGCCAAAATTCAAGACAAGGAGGGTATCCCACCTGACCAGCAGCGTCTGATATTTGCCGGCAAACAGCTGGAGGATGGCCGCACTCTCTCAGACTACAACATCCAGAAAGAGTCCACCCTGCACCTGGTGTTGCGCCTGCGAGGTGGCATTATTGAGCCTTCTCTCCGCCAGCTTGCCCAGAAATACAACTGCGACAAGATGATCTGCCGCAAGTGCTATGCTCGCCTTCACCCTCGTGCTGTCAACTGCCGCAAGAAGAAGTGTGGTCACACCAACAACCTGCGTCCCAAGAAGAAGGTCAAATAA
ORF Protein Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2368-Ab Anti-RL40/ UBA52/ CEP52 monoclonal antibody
    Target Antigen GM-Tg-g-MP2368-Ag UBA52 VLP (virus-like particle)
    ORF Viral Vector pGMLP003398 Human UBA52 Lentivirus plasmid
    ORF Viral Vector vGMLP003398 Human UBA52 Lentivirus particle


    Target information

    Target ID GM-MP2368
    Target Name UBA52
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7311
    Gene ID 100071005 (Equus caballus), 100144608 (Felis catus), 22186 (Mus musculus), 403722 (Canis lupus familiaris)
    615199 (Bos taurus), 64156 (Rattus norvegicus), 720243 (Macaca mulatta), 7311 (Homo sapiens)
    Gene Symbols & Synonyms UBA52,Uba52,CEP52,UBCEP2,Ubb,Ubc,Cep52,Gm1863,Rps27a,D8Ertd21e,UB-RPL40,UBB,UBC,RPS27A,L40,RPL40,HUBCEP52
    Target Alternative Names CEP52,Cep52,D8Ertd21e,Gm1863,HUBCEP52,L40,RPL40,RPS27A,Rps27a,UB-RPL40,UBA52,UBB,UBC,UBCEP2,Uba52,Ubb,Ubc,Ubiquitin A-52 residue ribosomal protein fusion product 1,Ubiquitin-ribosomal protein eL40 fusion protein
    Uniprot Accession P62984,P62986,P62987,P63048,P63050,P63052
    Additional SwissProt Accessions: P63052,P62984,P63050,P63048,P62986,P62987
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease Lung Cancer, Diabetic Nephropathy
    Disease from KEGG Kaposi sarcoma-associated herpesvirus infection
    Gene Ensembl ENSMUSG00000090137, ENSCAFG00845020932, ENSBTAG00000007737, ENSMMUG00000064485, ENSG00000221983
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.