Human PAFAH1B2/HEL-S-303 ORF/cDNA clone-Lentivirus plasmid (NM_002572)

Cat. No.: pGMLP002441
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PAFAH1B2/HEL-S-303 Lentiviral expression plasmid for PAFAH1B2 lentivirus packaging, PAFAH1B2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PAFAH1B2/HEL-S-303 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $472.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002441
Gene Name PAFAH1B2
Accession Number NM_002572
Gene ID 5049
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 690 bp
Gene Alias HEL-S-303
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCAAGGAGACTCAAACCCAGCAGCTATTCCGCATGCAGCAGAAGATATTCAAGGAGATGACCGATGGATGTCTCAGCACAACAGATTTGTTTTGGACTGTAAAGACAAAGAGCCTGATGTACTGTTCGTGGGAGACTCCATGGTGCAGTTAATGCAGCAATATGAGATATGGCGAGAGCTTTTTTCCCCACTTCATGCACTGAATTTTGGAATTGGGGGAGATACAACAAGACATGTTTTGTGGAGACTAAAGAATGGAGAACTGGAGAATATTAAGCCTAAGGTCATTGTTGTCTGGGTAGGAACAAATAACCACGAAAATACAGCAGAAGAAGTAGCAGGTGGGATCGAGGCCATTGTACAACTTATCAACACAAGGCAGCCACAGGCCAAAATCATTGTATTGGGTTTGTTACCTCGAGGTGAGAAACCCAATCCTTTGAGGCAAAAGAACGCCAAGGTGAACCAACTCCTCAAGGTTTCGCTGCCGAAGCTTGCCAACGTGCAGCTCCTGGATACCGACGGGGGTTTTGTGCACTCGGACGGTGCCATCTCCTGCCACGACATGTTTGATTTTCTGCATCTGACAGGAGGGGGCTATGCAAAGATCTGCAAACCCCTGCATGAACTGATCATGCAGTTGTTGGAGGAAACACCTGAGGAGAAACAAACCACCATTGCCTGA
ORF Protein Sequence MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2229-Ab Anti-PA1B2/ PAFAH1B2/ HEL-S-303 monoclonal antibody
    Target Antigen GM-Tg-g-MP2229-Ag PAFAH1B2 VLP (virus-like particle)
    ORF Viral Vector pGMLP002441 Human PAFAH1B2 Lentivirus plasmid
    ORF Viral Vector pGMPC001137 Human PAFAH1B2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002441 Human PAFAH1B2 Lentivirus particle


    Target information

    Target ID GM-MP2229
    Target Name PAFAH1B2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5049
    Gene ID 100062620 (Equus caballus), 101085656 (Felis catus), 119881476 (Canis lupus familiaris), 18475 (Mus musculus)
    282514 (Bos taurus), 5049 (Homo sapiens), 64189 (Rattus norvegicus), 703013 (Macaca mulatta)
    Gene Symbols & Synonyms PAFAH1B2,Pafah1b2,Pafahb,mus[b],2610005M20Rik,PAFAH1B2P68402,HEL-S-303
    Target Alternative Names 2610005M20Rik,HEL-S-303,PAF acetylhydrolase 30 kDa subunit (PAF-AH 30 kDa subunit),PAF-AH subunit beta (PAFAH subunit beta),PAFAH1B2,PAFAH1B2P68402,Pafah1b2,Pafahb,Platelet-activating factor acetylhydrolase IB subunit alpha2,mus[b]
    Uniprot Accession O35264,P68401,P68402,Q61206
    Additional SwissProt Accessions: Q61206,P68401,P68402,O35264
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Metabolic pathways, Ether lipid metabolism
    Gene Ensembl ENSECAG00000034204, ENSCAFG00845004183, ENSMUSG00000003131, ENSBTAG00000005627, ENSG00000168092, ENSMMUG00000002050
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.