Human IFI27/P27 ORF/cDNA clone-Adenovirus plasmid (BC015492)

Cat. No.: pGMAP000314
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IFI27/P27 adenoviral expression plasmid for IFI27 adenovirus packaging, IFI27 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IFI27/P27 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000314
Gene Name IFI27
Accession Number BC015492
Gene ID 3429
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 360 bp
Gene Alias P27
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGCCTCTGCTCTCACCTCATCAGCAGTGACCAGTGTGGCCAAAGTGGTCAGGGTGGCCTCTGGCTCTGCCGTAGTTTTGCCCCTGGCCAGGATTGCTACAGTTGTGATTGGAGGAGTTGTGGCTGTGCCCATGGTGCTCAGTGCCATGGGCTTCACTGCGGCGGGAATCGCCTCGTCCTCCATAGCAGCCAAGATGATGTCCGCGGCGGCCATTGCCAATGGGGGTGGAGTTGCCTCGGGCAGCCTTGTGGCTACTCTGCAGTCACTGGGAGCAACTGGACTCTCCGGATTGACCAAGTTCATCCTGGGCTCCATTGGGTCTGCCATTGCGGCTGTCATTGCGAGGTTCTACTAG
ORF Protein Sequence MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0997-Ab Anti-IFI27 monoclonal antibody
    Target Antigen GM-Tg-g-IP0997-Ag IFI27 protein
    ORF Viral Vector pGMLP000465 Human IFI27 Lentivirus plasmid
    ORF Viral Vector pGMLV001680 Human IFI27 Lentivirus plasmid
    ORF Viral Vector pGMAP000314 Human IFI27 Adenovirus plasmid
    ORF Viral Vector pGMPC001580 Human IFI27 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000465 Human IFI27 Lentivirus particle
    ORF Viral Vector vGMLV001680 Human IFI27 Lentivirus particle
    ORF Viral Vector vGMAP000314 Human IFI27 Adenovirus particle


    Target information

    Target ID GM-IP0997
    Target Name IFI27
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3429
    Gene ID 170512 (Rattus norvegicus), 3429 (Homo sapiens), 700513 (Macaca mulatta)
    Gene Symbols & Synonyms Ifi27,IFI27,IRG1,Ifi27l,Ifi27l1,isg12(a),P27,ISG12,FAM14D,ISG12A
    Target Alternative Names IFI27,Interferon alpha-inducible protein 27, mitochondrial,p27,Interferon alpha-induced 11.5 kDa protein, Interferon-stimulated gene 12a protein (ISG12(a), ISG12A),P27,ISG12,FAM14D,ISG12A
    Uniprot Accession P40305
    Additional SwissProt Accessions: P40305
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Ovary Cancer
    Disease from KEGG
    Gene Ensembl ENSG00000165949
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.