Human HMGB2/HMG2 ORF/cDNA clone-Lentivirus particle (NM_002129.4)

Cat. No.: vGMLV002520

Pre-made Human HMGB2/HMG2 Lentiviral expression plasmid for HMGB2 lentivirus packaging, HMGB2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HMGB2/HMG2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV002520 Human HMGB2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV002520
Gene Name HMGB2
Accession Number NM_002129.4
Gene ID 3148
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 630 bp
Gene Alias HMG2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTAAAGGAGACCCCAACAAGCCGCGGGGCAAAATGTCCTCGTACGCCTTCTTCGTGCAGACCTGCCGGGAAGAGCACAAGAAGAAACACCCGGACTCTTCCGTCAATTTCGCGGAATTCTCCAAGAAGTGTTCGGAGAGATGGAAGACCATGTCTGCAAAGGAGAAGTCGAAGTTTGAAGATATGGCAAAAAGTGACAAAGCTCGCTATGACAGGGAGATGAAAAATTACGTTCCTCCCAAAGGTGATAAGAAGGGGAAGAAAAAGGACCCCAATGCTCCTAAAAGGCCACCATCTGCCTTCTTCCTGTTTTGCTCTGAACATCGCCCAAAGATCAAAAGTGAACACCCTGGCCTATCCATTGGGGATACTGCAAAGAAATTGGGTGAAATGTGGTCTGAGCAGTCAGCCAAAGATAAACAACCATATGAACAGAAAGCAGCTAAGCTAAAGGAGAAATATGAAAAGGATATTGCTGCATATCGTGCCAAGGGCAAAAGTGAAGCAGGAAAGAAGGGCCCTGGCAGGCCAACAGGCTCAAAGAAGAAGAACGAACCAGAAGATGAGGAGGAGGAGGAGGAAGAAGAAGATGAAGATGAGGAGGAAGAGGATGAAGATGAAGAATAA
ORF Protein Sequence MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T12974-Ab Anti-HMGB2/ HMG2 functional antibody
    Target Antigen GM-Tg-g-T12974-Ag HMGB2 protein
    ORF Viral Vector pGMLP000379 Human HMG2 Lentivirus plasmid
    ORF Viral Vector pGMLV002520 Human HMGB2 Lentivirus plasmid
    ORF Viral Vector pGMPC000977 Human HMGB2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000379 Human HMG2 Lentivirus particle
    ORF Viral Vector vGMLV002520 Human HMGB2 Lentivirus particle


    Target information

    Target ID GM-T12974
    Target Name HMGB2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3148
    Gene ID 100061162 (Equus caballus), 101088835 (Felis catus), 29395 (Rattus norvegicus), 3148 (Homo sapiens)
    486068 (Canis lupus familiaris), 540444 (Bos taurus), 697057 (Macaca mulatta), 97165 (Mus musculus)
    Gene Symbols & Synonyms HMGB2,Hmgb2,Hmg2,HMG2,HMG-2
    Target Alternative Names HMGB2,High mobility group protein B2,High mobility group protein 2 (HMG-2),HMG2
    Uniprot Accession P26583,P30681,P40673,P52925
    Additional SwissProt Accessions: P52925,P26583,P40673,P30681
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000010132, ENSG00000164104, ENSCAFG00845017050, ENSBTAG00000015101, ENSMMUG00000003187, ENSMUSG00000054717
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.