Human PPIA/CYPA/CYPH ORF/cDNA clone-Lentivirus particle (NM_021130.5)

Cat. No.: vGMLV002305

Pre-made Human PPIA/CYPA/CYPH Lentiviral expression plasmid for PPIA lentivirus packaging, PPIA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Cyclophilin A/PPIA/PPIA/CYPA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV002305 Human PPIA Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV002305
Gene Name PPIA
Accession Number NM_021130.5
Gene ID 5478
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 498 bp
Gene Alias CYPA,CYPH,HEL-S-69p
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCAACCCCACCGTGTTCTTCGACATTGCCGTCGACGGCGAGCCCTTGGGCCGCGTCTCCTTTGAGCTGTTTGCAGACAAGGTCCCAAAGACAGCAGAAAATTTTCGTGCTCTGAGCACTGGAGAGAAAGGATTTGGTTATAAGGGTTCCTGCTTTCACAGAATTATTCCAGGGTTTATGTGTCAGGGTGGTGACTTCACACGCCATAATGGCACTGGTGGCAAGTCCATCTATGGGGAGAAATTTGAAGATGAGAACTTCATCCTAAAGCATACGGGTCCTGGCATCTTGTCCATGGCAAATGCTGGACCCAACACAAATGGTTCCCAGTTTTTCATCTGCACTGCCAAGACTGAGTGGTTGGATGGCAAGCATGTGGTGTTTGGCAAAGTGAAAGAAGGCATGAATATTGTGGAGGCCATGGAGCGCTTTGGGTCCAGGAATGGCAAGACCAGCAAGAAGATCACCATTGCTGACTGTGGACAACTCGAATAA
ORF Protein Sequence MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T47081-Ab Anti-PPIA/ CYPA/ CYPH functional antibody
    Target Antigen GM-Tg-g-T47081-Ag PPIA protein
    ORF Viral Vector pGMLV002304 Human PPIA Lentivirus plasmid
    ORF Viral Vector pGMLV002305 Human PPIA Lentivirus plasmid
    ORF Viral Vector pGMAD001436 Human PPIA Adenovirus plasmid
    ORF Viral Vector pGMAD001443 Human PPIA Adenovirus plasmid
    ORF Viral Vector pGMAP000039 Human PPIA Adenovirus plasmid
    ORF Viral Vector vGMLV002304 Human PPIA Lentivirus particle
    ORF Viral Vector vGMLV002305 Human PPIA Lentivirus particle
    ORF Viral Vector vGMAD001436 Human PPIA Adenovirus particle
    ORF Viral Vector vGMAD001443 Human PPIA Adenovirus particle
    ORF Viral Vector vGMAP000039 Human PPIA Adenovirus particle


    Target information

    Target ID GM-T47081
    Target Name Cyclophilin A/PPIA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5478
    Gene ID 100052020 (Equus caballus), 25518 (Rattus norvegicus), 268373 (Mus musculus), 281418 (Bos taurus)
    493966 (Felis catus), 5478 (Homo sapiens), 574102 (Macaca mulatta), 608151 (Canis lupus familiaris)
    Gene Symbols & Synonyms PPIA,Ppia,p31,CYCA,CyP-A,p1B15,Cphn,CypA,SP18,CyP-18,ND1,cypA,MTND1,NADH1,MT-ND1,CYPA,CYPH,HEL-S-69p
    Target Alternative Names CYCA,CYPA,CYPH,Cphn,CyP-18,CyP-A,Cyclophilin A,Cyclosporin A-binding protein,CypA,HEL-S-69p,MT-ND1,MTND1,NADH1,ND1,PPIA,PPIase A,Peptidyl-prolyl cis-trans isomerase A,Ppia,Rotamase A,SP18,cypA,p1B15,p31
    Uniprot Accession P10111,P17742,P48900,Q8HXS3,P62935,P62937,P62940
    Additional SwissProt Accessions: P10111,P17742,P62935,P48900,Q8HXS3,P62937,P62940
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000016673, ENSMUSG00000071866, ENSBTAG00000012003, ENSG00000196262, ENSMMUG00000016638
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.