Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human FGF21 ORF/cDNA clone-Lentivirus particle (NM_019113)
Cat. No.: vGMLV002194
Pre-made Human FGF21/ Lentiviral expression plasmid for FGF21 lentivirus packaging, FGF21 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FGF-21/FGF21/FGF21 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV002194 | Human FGF21 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV002194 |
| Gene Name | FGF21 |
| Accession Number | NM_019113 |
| Gene ID | 26291 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 630 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGACTCGGACGAGACCGGGTTCGAGCACTCAGGACTGTGGGTTTCTGTGCTGGCTGGTCTTCTGCTGGGAGCCTGCCAGGCACACCCCATCCCTGACTCCAGTCCTCTCCTGCAATTCGGGGGCCAAGTCCGGCAGCGGTACCTCTACACAGATGATGCCCAGCAGACAGAAGCCCACCTGGAGATCAGGGAGGATGGGACGGTGGGGGGCGCTGCTGACCAGAGCCCCGAAAGTCTCCTGCAGCTGAAAGCCTTGAAGCCGGGAGTTATTCAAATCTTGGGAGTCAAGACATCCAGGTTCCTGTGCCAGCGGCCAGATGGGGCCCTGTATGGATCGCTCCACTTTGACCCTGAGGCCTGCAGCTTCCGGGAGCTGCTTCTTGAGGACGGATACAATGTTTACCAGTCCGAAGCCCACGGCCTCCCGCTGCACCTGCCAGGGAACAAGTCCCCACACCGGGACCCTGCACCCCGAGGACCAGCTCGCTTCCTGCCACTACCAGGCCTGCCCCCCGCACTCCCGGAGCCACCCGGAATCCTGGCCCCCCAGCCCCCCGATGTGGGCTCCTCGGACCCTCTGAGCATGGTGGGACCTTCCCAGGGCCGAAGCCCCAGCTACGCTTCCTGA |
| ORF Protein Sequence | MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T42928-Ab | Anti-FGF21 functional antibody |
| Target Antigen | GM-Tg-g-T42928-Ag | FGF21 protein |
| Cytokine | cks-Tg-g-GM-T42928 | fibroblast growth factor 21 (FGF21) protein & antibody |
| ORF Viral Vector | pGMLP003451 | Human FGF21 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001311 | Human FGF21 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002194 | Human FGF21 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000245 | Human FGF21 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMLP003451 | Human FGF21 Lentivirus particle |
| ORF Viral Vector | vGMLV001311 | Human FGF21 Lentivirus particle |
| ORF Viral Vector | vGMLV002194 | Human FGF21 Lentivirus particle |
| ORF Viral Vector | vGMAAV000245 | Human FGF21 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T42928 |
| Target Name | FGF-21/FGF21 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
26291 |
| Gene ID |
100054542 (Equus caballus), 101080595 (Felis catus), 170580 (Rattus norvegicus), 26291 (Homo sapiens) 484395 (Canis lupus familiaris), 56636 (Mus musculus), 718288 (Macaca mulatta), 785576 (Bos taurus) |
| Gene Symbols & Synonyms | FGF21,Fgf21,FGF8C,Fgf8c |
| Target Alternative Names | FGF-21,FGF21,FGF8C,Fgf21,Fgf8c,Fibroblast growth factor 21 |
| Uniprot Accession |
Q9JJN1,Q9NSA1
Additional SwissProt Accessions: Q9NSA1,Q9JJN1 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma, Breast cancer, Gastric cancer |
| Gene Ensembl | ENSECAG00000010695, ENSG00000105550, ENSCAFG00845000788, ENSMUSG00000030827, ENSMMUG00000028737, ENSBTAG00000011624 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.