Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human RAC1/MIG5/MRD48 ORF/cDNA clone-Lentivirus particle (NM_006908.5)
Cat. No.: vGMLV001569
Pre-made Human RAC1/MIG5/MRD48 Lentiviral expression plasmid for RAC1 lentivirus packaging, RAC1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
RAC1/Rac1/RAC1/MIG5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV001569 | Human RAC1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV001569 |
| Gene Name | RAC1 |
| Accession Number | NM_006908.5 |
| Gene ID | 5879 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 579 bp |
| Gene Alias | MIG5,MRD48,p21-Rac1,Rac-1,TC-25 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGGCCATCAAGTGTGTGGTGGTGGGAGACGGAGCTGTAGGTAAAACTTGCCTACTGATCAGTTACACAACCAATGCATTTCCTGGAGAATATATCCCTACTGTCTTTGACAATTATTCTGCCAATGTTATGGTAGATGGAAAACCGGTGAATCTGGGCTTATGGGATACAGCTGGACAAGAAGATTATGACAGATTACGCCCCCTATCCTATCCGCAAACAGATGTGTTCTTAATTTGCTTTTCCCTTGTGAGTCCTGCATCATTTGAAAATGTCCGTGCAAAGTGGTATCCTGAGGTGCGGCACCACTGTCCCAACACTCCCATCATCCTAGTGGGAACTAAACTTGATCTTAGGGATGATAAAGACACGATCGAGAAACTGAAGGAGAAGAAGCTGACTCCCATCACCTATCCGCAGGGTCTAGCCATGGCTAAGGAGATTGGTGCTGTAAAATACCTGGAGTGCTCGGCGCTCACACAGCGAGGCCTCAAGACAGTGTTTGACGAAGCGATCCGAGCAGTCCTCTGCCCGCCTCCCGTGAAGAAGAGGAAGAGAAAATGCCTGCTGTTGTAA |
| ORF Protein Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T88752-Ab | Anti-RAC1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T88752-Ag | RAC1 protein |
| ORF Viral Vector | pGMLP005650 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000095 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000177 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000178 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000896 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001452 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001569 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002007 | Human RAC1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000586 | Human RAC1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000091 | Human RAC1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC000573 | Human RAC1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP005650 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMLV000095 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMLV000177 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMLV000178 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMLV000896 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMLV001452 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMLV001569 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMLV002007 | Human RAC1 Lentivirus particle |
| ORF Viral Vector | vGMAP000586 | Human RAC1 Adenovirus particle |
Target information
| Target ID | GM-T88752 |
| Target Name | RAC1/Rac1 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
5879 |
| Gene ID |
100061732 (Equus caballus), 101101277 (Felis catus), 19353 (Mus musculus), 281440 (Bos taurus) 363875 (Rattus norvegicus), 403955 (Canis lupus familiaris), 5879 (Homo sapiens), 717755 (Macaca mulatta) |
| Gene Symbols & Synonyms | RAC1,Rac1,D5Ertd559e,RAC2,MIG5,MRD48,Rac-1,TC-25,p21-Rac1 |
| Target Alternative Names | Cell migration-inducing gene 5 protein,D5Ertd559e,MIG5,MRD48,RAC1,RAC2,Rac-1,Rac1,Ras-like protein TC25,Ras-related C3 botulinum toxin substrate 1,TC-25,p21-Rac1 |
| Uniprot Accession |
P62998,P62999,P63000,P63001,Q6RUV5
Additional SwissProt Accessions: P63001,P62998,Q6RUV5,P62999,P63000 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer, Breast Cancer |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Sphingolipid signaling pathway, Phagosome, PI3K-Akt signaling pathway, Wnt signaling pathway, Axon guidance, Osteoclast differentiation, Focal adhesion, Adherens junction, Tight junction, Toll-like receptor signaling pathway, Natural killer cell mediated cytotoxicity, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Regulation of actin cytoskeleton, AGE-RAGE signaling pathway in diabetic complications, Pancreatic secretion, Epithelial cell signaling in Helicobacter pylori infection, Pathogenic Escherichia coli infection, Yersinia infection, Human cytomegalovirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Proteoglycans in cancer, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Choline metabolism in cancer, Viral myocarditis, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000009727, ENSMUSG00000001847, ENSBTAG00000053390, ENSCAFG00845010961, ENSG00000136238, ENSMMUG00000021075 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.