Human TACSTD2/EGP-1/EGP1 ORF/cDNA clone-Lentivirus particle (NM_002353)

Cat. No.: vGMLV001513

Pre-made Human TACSTD2/EGP-1/EGP1 Lentiviral expression plasmid for TACSTD2 lentivirus packaging, TACSTD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TACSTD2/TROP2/TACSTD2/EGP-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001513 Human TACSTD2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001513
Gene Name TACSTD2
Accession Number NM_002353
Gene ID 4070
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 972 bp
Gene Alias EGP-1,EGP1,GA733-1,GA7331,GP50,M1S1,TROP2
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCGGGGCCCCGGCCTCGCGCCGCCACCGCTGCGGCTGCCGCTGCTGCTGCTGGTGCTGGCGGCGGTGACCGGCCACACGGCCGCGCAGGACAACTGCACGTGTCCCACCAACAAGATGACCGTGTGCAGCCCCGACGGCCCCGGCGGCCGCTGCCAGTGCCGCGCGCTGGGCTCGGGCATGGCGGTCGACTGCTCCACGCTGACCTCCAAGTGTCTGCTGCTCAAGGCGCGCATGAGCGCCCCCAAGAACGCCCGCACGCTGGTGCGGCCGAGTGAGCACGCGCTCGTGGACAACGATGGCCTCTACGACCCCGACTGCGACCCCGAGGGCCGCTTCAAGGCGCGCCAGTGCAACCAGACGTCGGTGTGCTGGTGCGTGAACTCGGTGGGCGTGCGCCGCACGGACAAGGGCGACCTGAGCCTACGCTGCGATGAGCTGGTGCGCACCCACCACATCCTCATTGACCTGCGCCACCGCCCCACCGCCGGCGCCTTCAACCACTCAGACCTGGACGCCGAGCTGAGGCGGCTCTTCCGCGAGCGCTATCGGCTGCACCCCAAGTTCGTGGCGGCCGTGCACTACGAGCAGCCCACCATCCAGATCGAGCTGCGGCAGAACACGTCTCAGAAGGCCGCCGGTGACGTGGATATCGGCGATGCCGCCTACTACTTCGAGAGGGACATCAAGGGCGAGTCTCTATTCCAGGGCCGCGGCGGCCTGGACTTGCGCGTGCGCGGAGAACCCCTGCAGGTGGAGCGCACGCTCATCTATTACCTGGACGAGATTCCCCCGAAGTTCTCCATGAAGCGCCTCACCGCCGGCCTCATCGCCGTCATCGTGGTGGTCGTGGTGGCCCTCGTCGCCGGCATGGCCGTCCTGGTGATCACCAACCGGAGAAAGTCGGGGAAGTACAAGAAGGTGGAGATCAAGGAACTGGGGGAGTTGAGAAAGGAACCGAGCTTGTAG
ORF Protein Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-983 Pre-Made Sacituzumab Govitecan Biosimilar, Whole Mab Adc, Anti-Tacstd2 Antibody: Anti-EGP-1/EGP1/GA733-1/GA7331/GP50/M1S1/TROP2 therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-503 Pre-Made Sacituzumab biosimilar, Whole mAb ADC, Anti-TACSTD2 Antibody: Anti-EGP-1/EGP1/GA733-1/GA7331/GP50/M1S1/TROP2 therapeutic antibody
    Biosimilar GMP-Bios-ab-134 Pre-Made Datopotamab biosimilar, Whole mAb, Anti-TACSTD2 Antibody: Anti-EGP-1/EGP1/GA733-1/GA7331/GP50/M1S1/TROP2 therapeutic antibody
    Biosimilar GMP-Bios-INN-796 Pre-Made Datopotamab Deruxtecan Biosimilar, Whole Mab Adc, Anti-Tacstd2 Antibody: Anti-EGP-1/EGP1/GA733-1/GA7331/GP50/M1S1/TROP2 therapeutic antibody Drug Conjugate
    Target Antibody GM-Tg-g-IP0030-Ab Anti-TACSTD2 monoclonal antibody
    Target Antigen GM-Tg-g-IP0030-Ag TACSTD2 protein
    ORF Viral Vector pGMLP002819 Human TACSTD2 Lentivirus plasmid
    ORF Viral Vector pGMLV001513 Human TACSTD2 Lentivirus plasmid
    ORF Viral Vector pGMLV002492 Human TACSTD2 Lentivirus plasmid
    ORF Viral Vector vGMLP002819 Human TACSTD2 Lentivirus particle
    ORF Viral Vector vGMLV001513 Human TACSTD2 Lentivirus particle
    ORF Viral Vector vGMLV002492 Human TACSTD2 Lentivirus particle


    Target information

    Target ID GM-IP0030
    Target Name TACSTD2/TROP2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4070
    Gene ID 100067576 (Equus caballus), 101097004 (Felis catus), 4070 (Homo sapiens), 494343 (Rattus norvegicus)
    539853 (Bos taurus), 56753 (Mus musculus), 610286 (Canis lupus familiaris), 716334 (Macaca mulatta)
    Gene Symbols & Synonyms TACSTD2,Tacstd2,EGP1,GP50,M1S1,EGP-1,TROP2,GA7331,GA733-1,Prp1,Trop2,Ly97
    Target Alternative Names Cell surface glycoprotein Trop-2,EGP-1,EGP1,GA733-1,GA7331,GP50,Ly97,M1S1,Membrane component chromosome 1 surface marker 1,Pancreatic carcinoma marker protein GA733-1,Prp1,TACSTD2,TROP2,Tacstd2,Trop2,Tumor-associated calcium signal transducer 2
    Uniprot Accession P09758,Q6P9Z6,Q8BGV3
    Additional SwissProt Accessions: P09758,Q6P9Z6,Q8BGV3
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000004961, ENSG00000184292, ENSBTAG00000004381, ENSMUSG00000051397
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.