Human GADD45A/DDIT1/GADD45 ORF/cDNA clone-Lentivirus particle (NM_001924.4)

Cat. No.: vGMLV001473

Pre-made Human GADD45A/DDIT1/GADD45 Lentiviral expression plasmid for GADD45A lentivirus packaging, GADD45A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GADD45A/DDIT1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001473 Human GADD45A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001473
Gene Name GADD45A
Accession Number NM_001924.4
Gene ID 1647
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 498 bp
Gene Alias DDIT1,GADD45
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTTTGGAGGAATTCTCGGCTGGAGAGCAGAAGACCGAAAGGATGGATAAGGTGGGGGATGCCCTGGAGGAAGTGCTCAGCAAAGCCCTGAGTCAGCGCACGATCACTGTCGGGGTGTACGAAGCGGCCAAGCTGCTCAACGTCGACCCCGATAACGTGGTGTTGTGCCTGCTGGCGGCGGACGAGGACGACGACAGAGATGTGGCTCTGCAGATCCACTTCACCCTGATCCAGGCGTTTTGCTGCGAGAACGACATCAACATCCTGCGCGTCAGCAACCCGGGCCGGCTGGCGGAGCTCCTGCTCTTGGAGACCGACGCTGGCCCCGCGGCGAGCGAGGGCGCCGAGCAGCCCCCGGACCTGCACTGCGTGCTGGTGACGAATCCACATTCATCTCAATGGAAGGATCCTGCCTTAAGTCAACTTATTTGTTTTTGCCGGGAAAGTCGCTACATGGATCAATGGGTTCCAGTGATTAATCTCCCTGAACGGTGA
ORF Protein Sequence MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA007-Ab Anti-GADD45A monoclonal antibody
    Target Antigen GM-Tg-g-TA007-Ag GADD45A protein
    ORF Viral Vector pGMLV001473 Human GADD45A Lentivirus plasmid
    ORF Viral Vector pGMAP000143 Human GADD45A Adenovirus plasmid
    ORF Viral Vector vGMLV001473 Human GADD45A Lentivirus particle
    ORF Viral Vector vGMAP000143 Human GADD45A Adenovirus particle


    Target information

    Target ID GM-TA007
    Target Name GADD45A
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1647
    Gene ID 100630299 (Equus caballus), 100855728 (Canis lupus familiaris), 13197 (Mus musculus), 1647 (Homo sapiens)
    25112 (Rattus norvegicus), 493656 (Felis catus), 505463 (Bos taurus), 701054 (Macaca mulatta)
    Gene Symbols & Synonyms GADD45A,Gadd45a,Ddit1,GADD45,DDIT1,Gadd45
    Target Alternative Names DDIT1,DNA damage-inducible transcript 1 protein (DDIT-1),Ddit1,GADD45,GADD45A,Gadd45,Gadd45a,Growth arrest and DNA damage-inducible protein GADD45 alpha
    Uniprot Accession P24522,P48316,P48317,Q3ZBN6,Q60GI5
    Additional SwissProt Accessions: P48316,P24522,P48317,Q60GI5,Q3ZBN6
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Prostate Cancer
    Disease from KEGG MAPK signaling pathway, NF-kappa B signaling pathway, FoxO signaling pathway, p53 signaling pathway, Apoptosis, Cellular senescence, Epstein-Barr virus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Thyroid cancer, Basal cell carcinoma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer
    Gene Ensembl ENSMUSG00000036390, ENSG00000116717, ENSBTAG00000013860, ENSMMUG00000056103
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.