Human AGR2/AG-2/AG2 ORF/cDNA clone-Lentivirus particle (NM_006408.4)

Cat. No.: vGMLV001303

Pre-made Human AGR2/AG-2/AG2 Lentiviral expression plasmid for AGR2 lentivirus packaging, AGR2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to AGR2/AG-2/AGR2/AG-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001303 Human AGR2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001303
Gene Name AGR2
Accession Number NM_006408.4
Gene ID 10551
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 528 bp
Gene Alias AG-2,AG2,GOB-4,HAG-2,HEL-S-116,HPC8,PDIA17,XAG-2
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGAAAATTCCAGTGTCAGCATTCTTGCTCCTTGTGGCCCTCTCCTACACTCTGGCCAGAGATACCACAGTCAAACCTGGAGCCAAAAAGGACACAAAGGACTCTCGACCCAAACTGCCCCAGACCCTCTCCAGAGGTTGGGGTGACCAACTCATCTGGACTCAGACATATGAAGAAGCTCTATATAAATCCAAGACAAGCAACAAACCCTTGATGATTATTCATCACTTGGATGAGTGCCCACACAGTCAAGCTTTAAAGAAAGTGTTTGCTGAAAATAAAGAAATCCAGAAATTGGCAGAGCAGTTTGTCCTCCTCAATCTGGTTTATGAAACAACTGACAAACACCTTTCTCCTGATGGCCAGTATGTCCCCAGGATTATGTTTGTTGACCCATCTCTGACAGTTAGAGCCGATATCACTGGAAGATATTCAAATCGTCTCTATGCTTACGAACCTGCAGATACAGCTCTGTTGCTTGACAACATGAAGAAAGCTCTCAAGTTGCTGAAGACTGAATTGTAA
ORF Protein Sequence MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T34352-Ab Anti-AGR2/ AG-2/ AG2 functional antibody
    Target Antigen GM-Tg-g-T34352-Ag AG-2/AGR2 protein
    ORF Viral Vector pGMLV001303 Human AGR2 Lentivirus plasmid
    ORF Viral Vector pGMAD001490 Human AGR2 Adenovirus plasmid
    ORF Viral Vector pGMAP000150 Human AGR2 Adenovirus plasmid
    ORF Viral Vector vGMLV001303 Human AGR2 Lentivirus particle
    ORF Viral Vector vGMAD001490 Human AGR2 Adenovirus particle
    ORF Viral Vector vGMAP000150 Human AGR2 Adenovirus particle


    Target information

    Target ID GM-T34352
    Target Name AGR2/AG-2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10551
    Gene ID 100053075 (Equus caballus), 101084694 (Felis catus), 10551 (Homo sapiens), 23795 (Mus musculus)
    298961 (Rattus norvegicus), 415112 (Bos taurus), 482333 (Canis lupus familiaris), 709127 (Macaca mulatta)
    Gene Symbols & Synonyms AGR2,Agr2,AG2,AG-2,HPC8,GOB-4,HAG-2,RIFTD,XAG-2,PDIA17,HEL-S-116,Agr2h,Gob-4,mAG-2
    Target Alternative Names AG-2,AG2,AGR2,Agr2,Agr2h,Anterior gradient protein 2 homolog,GOB-4,Gob-4,HAG-2,HEL-S-116,HPC8,PDIA17,RIFTD,Secreted cement gland protein XAG-2 homolog,XAG-2,hAG-2,mAG-2
    Uniprot Accession O88312,O95994
    Additional SwissProt Accessions: O95994,O88312
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, Prostate Cancer, Malignant neoplasm of prostate
    Disease from KEGG
    Gene Ensembl ENSECAG00000043283, ENSG00000106541, ENSMUSG00000020581, ENSBTAG00000024406, ENSCAFG00845005787, ENSMMUG00000017050
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.