Human CD63/LAMP-3/ME491 ORF/cDNA clone-Lentivirus particle (NM_001780)

Cat. No.: vGMLV001024

Pre-made Human CD63/LAMP-3/ME491 Lentiviral expression plasmid for CD63 lentivirus packaging, CD63 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CD63/LAMP/CD63/LAMP-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001024 Human CD63 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001024
Gene Name CD63
Accession Number NM_001780
Gene ID 967
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 717 bp
Gene Alias LAMP-3,ME491,MLA1,OMA81H,TSPAN30
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGTGGAAGGAGGAATGAAATGTGTGAAGTTCTTGCTCTACGTCCTCCTGCTGGCCTTTTGCGCCTGTGCAGTGGGACTGATTGCCGTGGGTGTCGGGGCACAGCTTGTCCTGAGTCAGACCATAATCCAGGGGGCTACCCCTGGCTCTCTGTTGCCAGTGGTCATCATCGCAGTGGGTGTCTTCCTCTTCCTGGTGGCTTTTGTGGGCTGCTGCGGGGCCTGCAAGGAGAACTATTGTCTTATGATCACGTTTGCCATCTTTCTGTCTCTTATCATGTTGGTGGAGGTGGCCGCAGCCATTGCTGGCTATGTGTTTAGAGATAAGGTGATGTCAGAGTTTAATAACAACTTCCGGCAGCAGATGGAGAATTACCCGAAAAACAACCACACTGCTTCGATCCTGGACAGGATGCAGGCAGATTTTAAGTGCTGTGGGGCTGCTAACTACACAGATTGGGAGAAAATCCCTTCCATGTCGAAGAACCGAGTCCCCGACTCCTGCTGCATTAATGTTACTGTGGGCTGTGGGATTAATTTCAACGAGAAGGCGATCCATAAGGAGGGCTGTGTGGAGAAGATTGGGGGCTGGCTGAGGAAAAATGTGCTGGTGGTAGCTGCAGCAGCCCTTGGAATTGCTTTTGTCGAGGTTTTGGGAATTGTCTTTGCCTGCTGCCTCGTGAAGAGTATCAGAAGTGGCTACGAGGTGATGTAG
ORF Protein Sequence MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO085-Ab Anti-CD63/ LAMP/ LAMP-3 monoclonal antibody
    Target Antigen GM-Tg-g-IO085-Ag LAMP/CD63 VLP (virus-like particle)
    ORF Viral Vector pGMLP002280 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001022 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001024 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001026 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMLV001475 Human CD63 Lentivirus plasmid
    ORF Viral Vector pGMAAV000550 Human CD63 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000325 Human CD63 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002280 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001022 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001024 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001026 Human CD63 Lentivirus particle
    ORF Viral Vector vGMLV001475 Human CD63 Lentivirus particle
    ORF Viral Vector vGMAAV000550 Human CD63 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-IO085
    Target Name CD63/LAMP
    Gene Group Identifier
    (Target Gene ID in Homo species)
    967
    Gene ID 100051450 (Equus caballus), 12512 (Mus musculus), 29186 (Rattus norvegicus), 404156 (Bos taurus)
    474391 (Canis lupus familiaris), 493846 (Felis catus), 709828 (Macaca mulatta), 967 (Homo sapiens)
    Gene Symbols & Synonyms CD63,Cd63,ME491,Tspan30,AD1,MLA1,HOP-26,OMA81H,Pltgp40,TSPAN30
    Target Alternative Names AD1,CD63,CD63 antigen,Cd63,Granulophysin,HOP-26,LAMP,Lysosomal-associated membrane protein 3 (LAMP-3),Lysosome integral membrane protein 1 (Limp1),ME491,MLA1,Melanoma-associated antigen ME491,OMA81H,Ocular melanoma-associated antigen,Pltgp40,TSPAN30,Tetraspanin-30 (Tspan-30),Tspan30
    Uniprot Accession P08962,P28648,P41731,Q76B49,Q9XSK2
    Additional SwissProt Accessions: P41731,P28648,Q9XSK2,Q76B49,P08962
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer
    Disease from KEGG Lysosome, Proteoglycans in cancer
    Gene Ensembl ENSECAG00000046524, ENSMUSG00000025351, ENSBTAG00000011931, ENSCAFG00845005463, ENSMMUG00000013232, ENSG00000135404
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.