Human MAPK1/ERK/ERK-2 ORF/cDNA clone-Lentivirus particle (NM_002745.4)

Cat. No.: vGMLV000835

Pre-made Human MAPK1/ERK/ERK-2 Lentiviral expression plasmid for MAPK1 lentivirus packaging, MAPK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MAPK1/ERK2/MAPK1/ERK products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000835 Human MAPK1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000835
Gene Name MAPK1
Accession Number NM_002745.4
Gene ID 5594
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1083 bp
Gene Alias ERK,ERK-2,ERK2,ERT1,MAPK2,p38,p40,p41,p41mapk,p42-MAPK,P42MAPK,PRKM1,PRKM2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCGGCGGCGGCGGGCGCGGGCCCGGAGATGGTCCGCGGGCAGGTGTTCGACGTGGGGCCGCGCTACACCAACCTCTCGTACATCGGCGAGGGCGCCTACGGCATGGTGTGCTCTGCTTATGATAATGTCAACAAAGTTCGAGTAGCTATCAAGAAAATCAGCCCCTTTGAGCACCAGACCTACTGCCAGAGAACCCTGAGGGAGATAAAAATCTTACTGCGCTTCAGACATGAGAACATCATTGGAATCAATGACATTATTCGAGCACCAACCATCGAGCAAATGAAAGATGTATATATAGTACAGGACCTCATGGAAACAGATCTTTACAAGCTCTTGAAGACACAACACCTCAGCAATGACCATATCTGCTATTTTCTCTACCAGATCCTCAGAGGGTTAAAATATATCCATTCAGCTAACGTTCTGCACCGTGACCTCAAGCCTTCCAACCTGCTGCTCAACACCACCTGTGATCTCAAGATCTGTGACTTTGGCCTGGCCCGTGTTGCAGATCCAGACCATGATCACACAGGGTTCCTGACAGAATATGTGGCCACACGTTGGTACAGGGCTCCAGAAATTATGTTGAATTCCAAGGGCTACACCAAGTCCATTGATATTTGGTCTGTAGGCTGCATTCTGGCAGAAATGCTTTCTAACAGGCCCATCTTTCCAGGGAAGCATTATCTTGACCAGCTGAACCACATTTTGGGTATTCTTGGATCCCCATCACAAGAAGACCTGAATTGTATAATAAATTTAAAAGCTAGGAACTATTTGCTTTCTCTTCCACACAAAAATAAGGTGCCATGGAACAGGCTGTTCCCAAATGCTGACTCCAAAGCTCTGGACTTATTGGACAAAATGTTGACATTCAACCCACACAAGAGGATTGAAGTAGAACAGGCTCTGGCCCACCCATATCTGGAGCAGTATTACGACCCGAGTGACGAGCCCATCGCCGAAGCACCATTCAAGTTCGACATGGAATTGGATGACTTGCCTAAGGAAAAGCTCAAAGAACTAATTTTTGAAGAGACTGCTAGATTCCAGCCAGGATACAGATCTTAA
ORF Protein Sequence MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T58970-Ab Anti-ERK2 monoclonal antibody
    Target Antigen GM-Tg-g-T58970-Ag ERK2/MAPK1 protein
    ORF Viral Vector pGMLP005532 Human MAPK1 Lentivirus plasmid
    ORF Viral Vector pGMLP005592 Human MAPK1 Lentivirus plasmid
    ORF Viral Vector pGMLV000835 Human MAPK1 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-055 Human MAPK1 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-195 Human MAPK1 Adenovirus plasmid
    ORF Viral Vector pGMPC000321 Human MAPK1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005532 Human MAPK1 Lentivirus particle
    ORF Viral Vector vGMLP005592 Human MAPK1 Lentivirus particle
    ORF Viral Vector vGMLV000835 Human MAPK1 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-055 Human MAPK1 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-195 Human MAPK1 Adenovirus particle


    Target information

    Target ID GM-T58970
    Target Name MAPK1/ERK2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5594
    Gene ID 100057701 (Equus caballus), 101087614 (Felis catus), 116590 (Rattus norvegicus), 26413 (Mus musculus)
    327672 (Bos taurus), 477575 (Canis lupus familiaris), 5594 (Homo sapiens), 698569 (Macaca mulatta)
    Gene Symbols & Synonyms MAPK1,Mapk1,ERT1,Erk2,ERK-2,p42-MAPK,ERK,MAPK2,PRKM2,Prkm1,p41mapk,p42mapk,9030612K14Rik,ERK2,p38,p40,p41,NS13,PRKM1,P42MAPK
    Target Alternative Names 9030612K14Rik,ERK,ERK-2,ERK2,ERT1,Erk2,Extracellular signal-regulated kinase 2 (ERK-2),MAP kinase 1,MAP kinase isoform p42 (p42-MAPK),MAPK 1,MAPK 2),MAPK1,MAPK2,Mapk1,Mitogen-activated protein kinase 1,Mitogen-activated protein kinase 2 (MAP kinase 2,NS13,P42MAPK,PRKM1,PRKM2,Prkm1,p38,p40,p41,p41mapk,p42-MAPK,p42mapk
    Uniprot Accession P28482,P46196,P63085,P63086
    Additional SwissProt Accessions: P63086,P63085,P46196,P28482
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, Rap1 signaling pathway, cGMP-PKG signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, HIF-1 signaling pathway, FoxO signaling pathway, Sphingolipid signaling pathway, Phospholipase D signaling pathway, PI3K-Akt signaling pathway, Apoptosis, Cellular senescence, Adrenergic signaling in cardiomyocytes, Vascular smooth muscle contraction, TGF-beta signaling pathway, Axon guidance, Osteoclast differentiation, Focal adhesion, Adherens junction, Gap junction, Signaling pathways regulating pluripotency of stem cells, Platelet activation, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, TNF signaling pathway, Circadian entrainment, Long-term potentiation, Neurotrophin signaling pathway, Glutamatergic synapse, Cholinergic synapse, Serotonergic synapse, Regulation of actin cytoskeleton, GnRH signaling pathway, Melanogenesis, Prolactin signaling pathway, Thyroid hormone signaling pathway, Oxytocin signaling pathway, Relaxin signaling pathway, Parathyroid hormone synthesis, secretion and action, GnRH secretion, Type II diabetes mellitus, AGE-RAGE signaling pathway in diabetic complications, Cushing syndrome, Growth hormone synthesis, secretion and action, Aldosterone-regulated sodium reabsorption, Alzheimer disease, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, Toxoplasmosis, Tuberculosis, Hepatitis C, Hepatitis B, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Endometrial cancer, Glioma, Prostate cancer, Thyroid cancer, Melanoma, Bladder cancer, Chronic myeloid leukemia, Acute myeloid leukemia, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer, Central carbon metabolism in cancer, Choline metabolism in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000010551, ENSMUSG00000063358, ENSBTAG00000010312, ENSCAFG00845026389, ENSG00000100030, ENSMMUG00000012524
    Target Classification Kinase, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.