Human FGF2/BFGF/FGF-2 ORF/cDNA clone-Lentivirus particle (NM_002006)
Cat. No.: vGMLV000801
Pre-made Human FGF2/BFGF/FGF-2 Lentiviral expression plasmid for FGF2 lentivirus packaging, FGF2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FGF2/BFGF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000801 | Human FGF2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000801 |
| Gene Name | FGF2 |
| Accession Number | NM_002006 |
| Gene ID | 2247 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 867 bp |
| Gene Alias | BFGF,FGF-2,FGFB,HBGF-2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | CTGGTGGGTGTGGGGGGTGGAGATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAGATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTTGGGAGGCGGCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCCGGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGGGACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCCGGGGCCGTGCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCTCCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACCACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAGGACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGCCGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACATCAAGCTACAACTTCAAGCAGAAGAGAGAGGAGTTGTGTCTATCAAAGGAGTGTGTGCTAACCGTTACCTGGCTATGAAGGAAGATGGAAGATTACTGGCTTCTAAATGTGTTACGGATGAGTGTTTCTTTTTTGAACGATTGGAATCTAATAACTACAATACTTACCGGTCAAGGAAATACACCAGTTGGTATGTGGCACTGAAACGAACTGGGCAGTATAAACTTGGATCCAAAACAGGACCTGGGCAGAAAGCTATACTTTTTCTTCCAATGTCTGCTAAGAGCTGA |
| ORF Protein Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-INN-820 | Pre-Made Eflimrufusp Alfa Biosimilar, Fusion Protein targeting FGF2 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting BFGF/FGF-2/FGFB/HBGF-2 |
| Biosimilar | GMP-Bios-INN-969 | Pre-Made Recifercept biosimilar, Recombinant Protein: Recombinant therapeutic protein targeting FGF |
| Target Antibody | GM-Tg-g-T31621-Ab | Anti-FGF2/ BFGF/ FGF-2 functional antibody |
| Target Antigen | GM-Tg-g-T31621-Ag | FGF2 protein |
| Cytokine | cks-Tg-g-GM-T31621 | fibroblast growth factor 2 (basic) (FGF2) protein & antibody |
| ORF Viral Vector | pGMLV000801 | Human FGF2 Lentivirus plasmid |
| ORF Viral Vector | pGMAD000136 | Human FGF2 Adenovirus plasmid |
| ORF Viral Vector | vGMLV000801 | Human FGF2 Lentivirus particle |
| ORF Viral Vector | vGMAD000136 | Human FGF2 Adenovirus particle |
Target information
| Target ID | GM-T31621 |
| Target Name | FGF2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2247 |
| Gene ID |
100033955 (Equus caballus), 100135772 (Felis catus), 14173 (Mus musculus), 2247 (Homo sapiens) 281161 (Bos taurus), 403857 (Canis lupus familiaris), 54250 (Rattus norvegicus), 574136 (Macaca mulatta) |
| Gene Symbols & Synonyms | FGF2,Fgf2,Fgfb,bFGF,Fgf-2,Fgf2a,BFGF,FGFB,FGF-2,HBGF-2 |
| Target Alternative Names | BFGF,Basic fibroblast growth factor (bFGF),FGF-2,FGF2,FGFB,Fgf-2,Fgf2,Fgf2a,Fgfb,Fibroblast growth factor 2,HBGF-2,Heparin-binding growth factor 2 (HBGF-2),bFGF |
| Uniprot Accession |
P03969,P09038,P13109,P15655
Additional SwissProt Accessions: P15655,P09038,P03969,P13109 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | cancer, Breast Cancer |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Signaling pathways regulating pluripotency of stem cells, Regulation of actin cytoskeleton, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer |
| Gene Ensembl | ENSMUSG00000037225, ENSG00000138685 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


