Human IGF-1/IGF/IGF-I ORF/cDNA clone-Lentivirus particle (NM_001111283)

Cat. No.: vGMLV000664

Pre-made Human IGF-1/IGF/IGF-I Lentiviral expression plasmid for IGF-1 lentivirus packaging, IGF-1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IGF1/IGF-1/IGF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000664 Human IGF-1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000664
Gene Name IGF-1
Accession Number NM_001111283
Gene ID 3479
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 477 bp
Gene Alias IGF,IGF-I,IGFI,MGF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAAAAATCAGCAGTCTTCCAACCCAATTATTTAAGTGCTGCTTTTGTGATTTCTTGAAGGTGAAGATGCACACCATGTCCTCCTCGCATCTCTTCTACCTGGCGCTGTGCCTGCTCACCTTCACCAGCTCTGCCACGGCTGGACCGGAGACGCTCTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGAGACAGGGGCTTTTATTTCAACAAGCCCACAGGGTATGGCTCCAGCAGTCGGAGGGCGCCTCAGACAGGCATCGTGGATGAGTGCTGCTTCCGGAGCTGTGATCTAAGGAGGCTGGAGATGTATTGCGCACCCCTCAAGCCTGCCAAGTCAGCTCGCTCTGTCCGTGCCCAGCGCCACACCGACATGCCCAAGACCCAGAAGTATCAGCCCCCATCTACCAACAAGAACACGAAGTCTCAGAGAAGGAAAGGAAGTACATTTGAAGAACGCAAGTAG
ORF Protein Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEERK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-634 Pre-Made Xentuzumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Biosimilar GMP-Bios-ab-160 Pre-Made Dusigitumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Target Antibody GM-Tg-g-T60930-Ab Anti-IGF1/ IGF/ IGF-I functional antibody
    Target Antigen GM-Tg-g-T60930-Ag IGF1 protein
    Cytokine cks-Tg-g-GM-T60930 insulin-like growth factor 1 (IGF1) protein & antibody
    ORF Viral Vector pGMLP003306 Human IGF1 Lentivirus plasmid
    ORF Viral Vector pGMLV000664 Human IGF-1 Lentivirus plasmid
    ORF Viral Vector pGMAD000056 Human IGF1 Adenovirus plasmid
    ORF Viral Vector pGMAAV001559 Human IGF1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003306 Human IGF1 Lentivirus particle
    ORF Viral Vector vGMLV000664 Human IGF-1 Lentivirus particle
    ORF Viral Vector vGMAD000056 Human IGF1 Adenovirus particle
    ORF Viral Vector vGMAAV001559 Human IGF1 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T60930
    Target Name IGF1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3479
    Gene ID 100034198 (Equus caballus), 101101237 (Felis catus), 16000 (Mus musculus), 24482 (Rattus norvegicus)
    281239 (Bos taurus), 3479 (Homo sapiens), 610255 (Canis lupus familiaris), 698444 (Macaca mulatta)
    Gene Symbols & Synonyms IGF1,Igf1,Igf-1,Igf-I,C730016P09Rik,IGF,IGF-1,IGF-I,MGF,IGFI,IGFIA
    Target Alternative Names C730016P09Rik,IGF,IGF-1,IGF-I,IGF1,IGFI,IGFIA,Igf-1,Igf-I,Igf1,Insulin-like growth factor 1,Insulin-like growth factor I (IGF-I),MGF,Mechano growth factor (MGF),Somatomedin-C
    Uniprot Accession P05017,P05019,P07455,P08025,P33712,P51458
    Additional SwissProt Accessions: P51458,P05017,P08025,P07455,P05019,P33712
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease cancer, Prostate Cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, HIF-1 signaling pathway, FoxO signaling pathway, p53 signaling pathway, PI3K-Akt signaling pathway, Longevity regulating pathway, Longevity regulating pathway - multiple species, Focal adhesion, Signaling pathways regulating pluripotency of stem cells, Inflammatory mediator regulation of TRP channels, Ovarian steroidogenesis, Growth hormone synthesis, secretion and action, Aldosterone-regulated sodium reabsorption, Pathways in cancer, Proteoglycans in cancer, Glioma, Prostate cancer, Melanoma, Breast cancer, Hypertrophic cardiomyopathy, Dilated cardiomyopathy
    Gene Ensembl ENSECAG00000010109, ENSMUSG00000020053, ENSBTAG00000011082, ENSG00000017427, ENSCAFG00845009366, ENSMMUG00000002235
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.