Human STMN1/C1orf215/Lag ORF/cDNA clone-Lentivirus particle (NM_001145454.2)
Cat. No.: vGMLV000379
Pre-made Human STMN1/C1orf215/Lag Lentiviral expression plasmid for STMN1 lentivirus packaging, STMN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
Stathmin 1/STMN1/STMN1/C1orf215 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000379 | Human STMN1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000379 |
| Gene Name | STMN1 |
| Accession Number | NM_001145454.2 |
| Gene ID | 3925 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 525 bp |
| Gene Alias | C1orf215,Lag,LAP18,OP18,PP17,PP19,PR22,SMN |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTTCTTCTGATATCCAGGTGAAAGAACTGGAGAAGCGTGCCTCAGGCCAGGCTTTTGAGCTGATTCTCAGCCCTCGGTCAAAAGAATCTGTTCCAGAATTCCCCCTTTCCCCTCCAAAGAAGAAGGATCTTTCCCTGGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCAAGTCCCATGAAGCTGAGGTCTTGAAGCAGCTGGCTGAGAAACGAGAGCACGAGAAAGAAGTGCTTCAGAAGGCAATAGAAGAGAACAACAACTTCAGTAAAATGGCAGAAGAGAAACTGACCCACAAAATGGAAGCTAATAAAGAGAACCGAGAGGCACAAATGGCTGCCAAACTGGAACGTTTGCGAGAGAAGATGTACTTCTGGACTCACGGGCCTGGGGCCCACCCAGCACAGATCTCTGCTGAGCAATCTTGTCTCCACTCTGTTCCTGCCCTTTGCCCAGCCCTGGGCCTCCAATCTGCATTGATTACCTGGTCTGATCTCTCTCACCATCACTAG |
| ORF Protein Sequence | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKMYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0228-Ab | Anti-STMN1 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0228-Ag | STMN1 protein |
| ORF Viral Vector | pGMLV000379 | Human STMN1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000481 | Human STMN1 Lentivirus plasmid |
| ORF Viral Vector | pGMAD000071 | Human STMN1 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000293 | Human STMN1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000150 | Human STMN1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLV000379 | Human STMN1 Lentivirus particle |
| ORF Viral Vector | vGMLV000481 | Human STMN1 Lentivirus particle |
| ORF Viral Vector | vGMAD000071 | Human STMN1 Adenovirus particle |
| ORF Viral Vector | vGMAP000293 | Human STMN1 Adenovirus particle |
Target information
| Target ID | GM-IP0228 |
| Target Name | Stathmin 1/STMN1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3925 |
| Gene ID |
100057411 (Equus caballus), 101082582 (Felis catus), 16765 (Mus musculus), 29332 (Rattus norvegicus) 3925 (Homo sapiens), 478175 (Canis lupus familiaris), 616317 (Bos taurus), 719733 (Macaca mulatta) |
| Gene Symbols & Synonyms | STMN1,Stmn1,19k,Lag,P18,P19,Pig,Smn,Op18,Pp17,Pp18,Pp19,Pr22,Lap18,SMN,OP18,PP17,PP19,PR22,prosolin,LAP18,C1orf215 |
| Target Alternative Names | 19k,C1orf215,LAP18,Lag,Lap18,Leukemia-associated phosphoprotein p18,Metablastin,OP18,Oncoprotein 18 (Op18),Op18,P18,P19,PP17,PP19,PR22,Phosphoprotein p19 (pp19),Pig,Pp17,Pp18,Pp19,Pr22,Prosolin,Protein Pr22,SMN,STMN1,Smn,Stathmin,Stathmin 1,Stmn1,pp17,prosolin |
| Uniprot Accession |
P13668,P16949,P54227,Q3T0C7
Additional SwissProt Accessions: P54227,P13668,P16949,Q3T0C7 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | |
| Disease | cancer |
| Disease from KEGG | MAPK signaling pathway |
| Gene Ensembl | ENSMUSG00000028832, ENSG00000117632, ENSCAFG00845013518, ENSBTAG00000013761, ENSMMUG00000000653 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


