Human GDNF/ATF/ATF1 ORF/cDNA clone-Lentivirus particle (NM_001190468)
Cat. No.: vGMLV000366
Pre-made Human GDNF/ATF/ATF1 Lentiviral expression plasmid for GDNF lentivirus packaging, GDNF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GDNF/ATF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000366 | Human GDNF Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000366 |
| Gene Name | GDNF |
| Accession Number | NM_001190468 |
| Gene ID | 2668 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 687 bp |
| Gene Alias | ATF,ATF1,ATF2,HFB1-GDNF,HSCR3 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGTCTTTGCCTAACAGCAATGGTGCCGCCGCCGGACGGGACTTTAAGATGAAGTTATGGGATGTCGTGGCTGTCTGCCTGGTGCTGCTCCACACCGCGTCCGCCTTCCCGCTGCCCGCCGGTAAGAGGCCTCCCGAGGCGCCCGCCGAAGACCGCTCCCTCGGCCGCCGCCGCGCGCCCTTCGCGCTGAGCAGTGACTCAAATATGCCAGAGGATTATCCTGATCAGTTCGATGATGTCATGGATTTTATTCAAGCCACCATTAAAAGACTGAAAAGGTCACCAGATAAACAAATGGCAGTGCTTCCTAGAAGAGAGCGGAATCGGCAGGCTGCAGCTGCCAACCCAGAGAATTCCAGAGGAAAAGGTCGGAGAGGCCAGAGGGGCAAAAACCGGGGTTGTGTCTTAACTGCAATACATTTAAATGTCACTGACTTGGGTCTGGGCTATGAAACCAAGGAGGAACTGATTTTTAGGTACTGCAGCGGCTCTTGCGATGCAGCTGAGACAACGTACGACAAAATATTGAAAAACTTATCCAGAAATAGAAGGCTGGTGAGTGACAAAGTAGGGCAGGCATGTTGCAGACCCATCGCCTTTGATGATGACCTGTCGTTTTTAGATGATAACCTGGTTTACCATATTCTAAGAAAGCATTCCGCTAAAAGGTGTGGATGTATCTGA |
| ORF Protein Sequence | MQSLPNSNGAAAGRDFKMKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T79160-Ab | Anti-GDNF/ ATF/ ATF1 functional antibody |
| Target Antigen | GM-Tg-g-T79160-Ag | GDNF protein |
| Cytokine | cks-Tg-g-GM-T79160 | glial cell derived neurotrophic factor (GDNF) protein & antibody |
| ORF Viral Vector | pGMLP002678 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMLV000366 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMLV000484 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMLV001834 | Human GDNF Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-284 | Human GDNF Adenovirus plasmid |
| ORF Viral Vector | vGMLP002678 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMLV000366 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMLV000484 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMLV001834 | Human GDNF Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-284 | Human GDNF Adenovirus particle |
Target information
| Target ID | GM-T79160 |
| Target Name | GDNF |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2668 |
| Gene ID |
100067053 (Equus caballus), 101097871 (Felis catus), 119871563 (Canis lupus familiaris), 14573 (Mus musculus) 25453 (Rattus norvegicus), 2668 (Homo sapiens), 386587 (Bos taurus), 706345 (Macaca mulatta) |
| Gene Symbols & Synonyms | GDNF,Gdnf,ATF,gndf,ATF1,ATF2,HSCR3,HFB1-GDNF |
| Target Alternative Names | ATF,ATF1,ATF2,Astrocyte-derived trophic factor (ATF),GDNF,Gdnf,Glial cell line-derived neurotrophic factor,HFB1-GDNF,HSCR3,gndf,hGDNF |
| Uniprot Accession |
P39905,P48540,Q07731
Additional SwissProt Accessions: P48540,Q07731,P39905 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
| Disease | cancer, Lung Cancer |
| Disease from KEGG | Calcium signaling pathway |
| Gene Ensembl | ENSECAG00000037655, ENSCAFG00845003744, ENSMUSG00000022144, ENSG00000168621, ENSBTAG00000005176, ENSMMUG00000018963 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


