Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human HMGA2/BABL/HMGI-C ORF/cDNA clone-Lentivirus particle (NM_003483.4)
Cat. No.: vGMLV000253
Pre-made Human HMGA2/BABL/HMGI-C Lentiviral expression plasmid for HMGA2 lentivirus packaging, HMGA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
HMGA2/BABL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000253 | Human HMGA2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000253 |
| Gene Name | HMGA2 |
| Accession Number | NM_003483.4 |
| Gene ID | 8091 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 330 bp |
| Gene Alias | BABL,HMGI-C,HMGIC,LIPO,STQTL9 |
| Fluorescent Reporter | Firefly luciferase |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCGCACGCGGTGAGGGCGCGGGGCAGCCGTCCACTTCAGCCCAGGGACAACCTGCCGCCCCAGCGCCTCAGAAGAGAGGACGCGGCCGCCCCAGGAAGCAGCAGCAAGAACCAACCGGTGAGCCCTCTCCTAAGAGACCCAGGGGAAGACCCAAAGGCAGCAAAAACAAGAGTCCCTCTAAAGCAGCTCAAAAGAAAGCAGAAGCCACTGGAGAAAAACGGCCAAGAGGCAGACCTAGGAAATGGCCACAACAAGTTGTTCAGAAGAAGCCTGCTCAGGAGGAAACTGAAGAGACATCCTCACAAGAGTCTGCCGAAGAGGACTAG |
| ORF Protein Sequence | MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T48166-Ab | Anti-HMGA2 monoclonal antibody |
| Target Antigen | GM-Tg-g-T48166-Ag | HMGA2 protein |
| ORF Viral Vector | pGMLV000253 | Human HMGA2 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000254 | Human HMGA2 Lentivirus plasmid |
| ORF Viral Vector | vGMLV000253 | Human HMGA2 Lentivirus particle |
| ORF Viral Vector | vGMLV000254 | Human HMGA2 Lentivirus particle |
Target information
| Target ID | GM-T48166 |
| Target Name | HMGA2 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
8091 |
| Gene ID |
100271859 (Canis lupus familiaris), 100297155 (Bos taurus), 102149270 (Equus caballus), 111561386 (Felis catus) 15364 (Mus musculus), 717721 (Macaca mulatta), 8091 (Homo sapiens), 84017 (Rattus norvegicus) |
| Gene Symbols & Synonyms | HMGA2,Hmga2,pg,Hmgic,pygmy,HMGI-C,9430083A20Rik,BABL,LIPO,SRS5,HMGIC,STQTL9 |
| Target Alternative Names | 9430083A20Rik,BABL,HMGA2,HMGI-C,HMGIC,High mobility group AT-hook protein 2,High mobility group protein HMGI-C,Hmga2,Hmgic,LIPO,SRS5,STQTL9,pg,pygmy |
| Uniprot Accession |
P52926,P52927
Additional SwissProt Accessions: P52927,P52926 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSCAFG00845012436, ENSBTAG00000044118, ENSECAG00000040252, ENSMUSG00000056758, ENSG00000149948 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.