Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human BCAP31/6C6-AG/BAP31 ORF/cDNA clone-Lentivirus particle (NM_005745.7)
Cat. No.: vGMLV000207
Pre-made Human BCAP31/6C6-AG/BAP31 Lentiviral expression plasmid for BCAP31 lentivirus packaging, BCAP31 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
BAP31/BCAP31/BCAP31/6C6-AG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000207 | Human BCAP31 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000207 |
| Gene Name | BCAP31 |
| Accession Number | NM_005745.7 |
| Gene ID | 10134 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 741 bp |
| Gene Alias | 6C6-AG,BAP31,CDM,DDCH,DXS1357E |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGTCTGCAGTGGACTGCAGTTGCCACCTTCCTCTATGCGGAGGTCTTTGTTGTGTTGCTTCTCTGCATTCCCTTCATTTCTCCTAAAAGATGGCAGAAGATTTTCAAGTCCCGGCTGGTGGAGTTGTTAGTGTCCTATGGCAACACCTTCTTTGTGGTTCTCATTGTCATCCTTGTGCTGTTGGTCATCGATGCCGTGCGCGAAATTCGGAAGTATGATGATGTGACGGAAAAGGTGAACCTCCAGAACAATCCCGGGGCCATGGAGCACTTCCACATGAAGCTTTTCCGTGCCCAGAGGAATCTCTACATTGCTGGCTTTTCCTTGCTGCTGTCCTTCCTGCTTAGACGCCTGGTGACTCTCATTTCGCAGCAGGCCACGCTGCTGGCCTCCAATGAAGCCTTTAAAAAGCAGGCGGAGAGTGCTAGTGAGGCGGCCAAGAAGTACATGGAGGAGAATGACCAGCTCAAGAAGGGAGCTGCTGTTGACGGAGGCAAGTTGGATGTCGGGAATGCTGAGGTGAAGTTGGAGGAAGAGAACAGGAGCCTGAAGGCTGACCTGCAGAAGCTAAAGGACGAGCTGGCCAGCACTAAGCAAAAACTAGAGAAAGCTGAAAACCAGGTTCTGGCCATGCGGAAGCAGTCTGAGGGCCTCACCAAGGAGTACGACCGCTTGCTGGAGGAGCACGCAAAGCTGCAGGCTGCAGTAGATGGTCCCATGGACAAGAAGGAAGAGTAA |
| ORF Protein Sequence | MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0414-Ab | Anti-BCAP31 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0414-Ag | BCAP31 protein |
| ORF Viral Vector | pGMLP004845 | Human BCAP31 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000207 | Human BCAP31 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004845 | Human BCAP31 Lentivirus particle |
| ORF Viral Vector | vGMLV000207 | Human BCAP31 Lentivirus particle |
Target information
| Target ID | GM-IP0414 |
| Target Name | BAP31/BCAP31 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
10134 |
| Gene ID |
100058834 (Equus caballus), 101081202 (Felis catus), 10134 (Homo sapiens), 27061 (Mus musculus) 293852 (Rattus norvegicus), 481080 (Canis lupus familiaris), 533949 (Bos taurus), 696663 (Macaca mulatta) |
| Gene Symbols & Synonyms | BCAP31,Bcap31,CDM,DDCH,BAP31,6C6-AG,DELXQ28,DXS1357E,MICRODELXq28,Bap31 |
| Target Alternative Names | 6C6-AG,6C6-AG tumor-associated antigen,B-cell receptor-associated protein 31,BAP31,BCAP31,BCR-associated protein 31,Bap31,Bcap31,CDM,DDCH,DELXQ28,DXS1357E,MICRODELXq28,Protein CDM,p28 |
| Uniprot Accession |
P51572,Q61335
Additional SwissProt Accessions: P51572,Q61335 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | |
| Disease | |
| Disease from KEGG | Protein processing in endoplasmic reticulum, Human papillomavirus infection |
| Gene Ensembl | ENSECAG00000022787, ENSG00000185825, ENSMUSG00000002015, ENSCAFG00845024213, ENSBTAG00000020547, ENSMMUG00000012744 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.