Human SIGMAR1/ALS16/DSMA2 ORF/cDNA clone-Lentivirus particle (NM_005866.3)

Cat. No.: vGMLV000203

Pre-made Human SIGMAR1/ALS16/DSMA2 Lentiviral expression plasmid for SIGMAR1 lentivirus packaging, SIGMAR1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SIGMAR1/OPRS1/SIGMAR1/ALS16 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000203 Human SIGMAR1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000203
Gene Name SIGMAR1
Accession Number NM_005866.3
Gene ID 10280
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 672 bp
Gene Alias ALS16,DSMA2,hSigmaR1,OPRS1,SIG-1R,sigma1R,SR-BP,SR-BP1,SRBP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGTGGGCCGTGGGCCGGCGGTGGGCGTGGGCCGCGCTGCTCCTGGCTGTCGCAGCGGTGCTGACCCAGGTCGTCTGGCTCTGGCTGGGTACGCAGAGCTTCGTCTTCCAGCGCGAAGAGATAGCGCAGTTGGCGCGGCAGTACGCTGGGCTGGACCACGAGCTGGCCTTCTCTCGTCTGATCGTGGAGCTGCGGCGGCTGCACCCAGGCCACGTGCTGCCCGACGAGGAGCTGCAGTGGGTGTTCGTGAATGCGGGTGGCTGGATGGGCGCCATGTGCCTTCTGCACGCCTCGCTGTCCGAGTATGTGCTGCTCTTCGGCACCGCCTTGGGCTCCCGCGGCCACTCGGGGCGCTACTGGGCTGAGATCTCGGATACCATCATCTCTGGCACCTTCCACCAGTGGAGAGAGGGCACCACCAAAAGTGAGGTCTTCTACCCAGGGGAGACGGTAGTACACGGGCCTGGTGAGGCAACAGCTGTGGAGTGGGGGCCAAACACATGGATGGTGGAGTACGGCCGGGGCGTCATCCCATCCACCCTGGCCTTCGCGCTGGCCGACACTGTCTTCAGCACCCAGGACTTCCTCACCCTCTTCTATACTCTTCGCTCCTATGCTCGGGGCCTCCGGCTTGAGCTCACCACCTACCTCTTTGGCCAGGACCCTTGA
ORF Protein Sequence MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0013-Ab Anti-OPRS1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0013-Ag OPRS1/SIGMAR1 protein
    ORF Viral Vector pGMLV000203 Human SIGMAR1 Lentivirus plasmid
    ORF Viral Vector vGMLV000203 Human SIGMAR1 Lentivirus particle


    Target information

    Target ID GM-IP0013
    Target Name SIGMAR1/OPRS1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    10280
    Gene ID 100068507 (Equus caballus), 101084912 (Felis catus), 10280 (Homo sapiens), 18391 (Mus musculus)
    29336 (Rattus norvegicus), 481587 (Canis lupus familiaris), 538903 (Bos taurus), 700469 (Macaca mulatta)
    Gene Symbols & Synonyms SIGMAR1,Sigmar1,SRBP,ALS16,DSMA2,HMNR2,OPRS1,SR-BP,SIG-1R,SR-BP1,sigma1R,hSigmaR1,Oprs1,Sig1R
    Target Alternative Names ALS16,Aging-associated gene 8 protein,DSMA2,HMNR2,OPRS1,Oprs1,SIG-1R,SIGMAR1,SR-BP,SR-BP1,SR31747-binding protein (SR-BP),SRBP,Sig1R,Sigma 1-type opioid receptor (SIG-1R,Sigma non-opioid intracellular receptor 1,Sigma1-receptor,Sigma1R,Sigmar1,hSigmaR1,hSigmaR1),sigma1R
    Uniprot Accession O55242,Q58DH7,Q99720,Q9R0C9
    Additional SwissProt Accessions: Q99720,O55242,Q9R0C9,Q58DH7
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000019783, ENSG00000147955, ENSMUSG00000036078, ENSCAFG00845024716, ENSBTAG00000015804, ENSMMUG00000020774
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.