Human SOST/CDD/DAND6 ORF/cDNA clone-Lentivirus particle (NM_025237)

Cat. No.: vGMLV000058

Pre-made Human SOST/CDD/DAND6 Lentiviral expression plasmid for SOST lentivirus packaging, SOST lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SOST/Sclerostin/SOST/CDD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000058 Human SOST Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000058
Gene Name SOST
Accession Number NM_025237
Gene ID 50964
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 642 bp
Gene Alias CDD,DAND6,SOST1,VBCH
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCTCCCACTGGCCCTGTGTCTCGTCTGCCTGCTGGTACACACAGCCTTCCGTGTAGTGGAGGGCCAGGGGTGGCAGGCGTTCAAGAATGATGCCACGGAAATCATCCCCGAGCTCGGAGAGTACCCCGAGCCTCCACCGGAGCTGGAGAACAACAAGACCATGAACCGGGCGGAGAACGGAGGGCGGCCTCCCCACCACCCCTTTGAGACCAAAGACGTGTCCGAGTACAGCTGCCGCGAGCTGCACTTCACCCGCTACGTGACCGATGGGCCGTGCCGCAGCGCCAAGCCGGTCACCGAGCTGGTGTGCTCCGGCCAGTGCGGCCCGGCGCGCCTGCTGCCCAACGCCATCGGCCGCGGCAAGTGGTGGCGACCTAGTGGGCCCGACTTCCGCTGCATCCCCGACCGCTACCGCGCGCAGCGCGTGCAGCTGCTGTGTCCCGGTGGTGAGGCGCCGCGCGCGCGCAAGGTGCGCCTGGTGGCCTCGTGCAAGTGCAAGCGCCTCACCCGCTTCCACAACCAGTCGGAGCTCAAGGACTTCGGGACCGAGGCCGCTCGGCCGCAGAAGGGCCGGAAGCCGCGGCCCCGCGCCCGGAGCGCCAAAGCCAACCAGGCCGAGCTGGAGAACGCCTACTAG
ORF Protein Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-493 Pre-Made Romosozumab biosimilar, Whole mAb, Anti-SOST Antibody: Anti-CDD/DAND6/VBCH therapeutic antibody
    Biosimilar GMP-Bios-ab-076 Pre-Made Blosozumab biosimilar, Whole mAb, Anti-SOST Antibody: Anti-CDD/DAND6/VBCH therapeutic antibody
    Biosimilar GMP-Bios-ab-517 Pre-Made Setrusumab biosimilar, Whole mAb, Anti-SOST Antibody: Anti-CDD/DAND6/VBCH therapeutic antibody
    Target Antibody GM-Tg-g-T60724-Ab Anti-SOST/ CDD/ DAND61 functional antibody
    Target Antigen GM-Tg-g-T60724-Ag SOST protein
    ORF Viral Vector pGMLP005026 Human SOST Lentivirus plasmid
    ORF Viral Vector pGMLV000058 Human SOST Lentivirus plasmid
    ORF Viral Vector pGMLV000548 Human SOST Lentivirus plasmid
    ORF Viral Vector pGMPC000724 Human SOST Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005026 Human SOST Lentivirus particle
    ORF Viral Vector vGMLV000058 Human SOST Lentivirus particle
    ORF Viral Vector vGMLV000548 Human SOST Lentivirus particle


    Target information

    Target ID GM-T60724
    Target Name SOST/Sclerostin
    Gene Group Identifier
    (Target Gene ID in Homo species)
    50964
    Gene ID 100065060 (Equus caballus), 101083725 (Felis catus), 282880 (Bos taurus), 490948 (Canis lupus familiaris)
    50964 (Homo sapiens), 713617 (Macaca mulatta), 74499 (Mus musculus), 80722 (Rattus norvegicus)
    Gene Symbols & Synonyms SOST,Sost,CDD,VBCH,DAND6,SOST1,5430411E23Rik
    Target Alternative Names 5430411E23Rik,CDD,DAND6,SOST,SOST1,Sclerostin,Sost,VBCH
    Uniprot Accession Q99P67,Q99P68,Q9BG79,Q9BQB4
    Additional SwissProt Accessions: Q9BG79,Q9BQB4,Q99P68,Q99P67
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease Breast Cancer
    Disease from KEGG Wnt signaling pathway, Parathyroid hormone synthesis, secretion and action
    Gene Ensembl ENSECAG00000011911, ENSCAFG00845010604, ENSG00000167941, ENSMMUG00000058522, ENSMUSG00000001494
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.