Human IL6/BSF-2/BSF2 ORF/cDNA clone-Lentivirus particle (NM_000600)
Cat. No.: vGMLV000053
Pre-made Human IL6/BSF-2/BSF2 Lentiviral expression plasmid for IL6 lentivirus packaging, IL6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IL-6/IL6/IL6/BSF-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV000053 | Human IL6 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV000053 |
Gene Name | IL6 |
Accession Number | NM_000600 |
Gene ID | 3569 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 639 bp |
Gene Alias | BSF-2,BSF2,CDF,HGF,HSF,IFN-beta-2,IFNB2,IL-6 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAACTCCTTCTCCACAAGCGCCTTCGGTCCAGTTGCCTTCTCCCTGGGGCTGCTCCTGGTGTTGCCTGCTGCCTTCCCTGCCCCAGTACCCCCAGGAGAAGATTCCAAAGATGTAGCCGCCCCACACAGACAGCCACTCACCTCTTCAGAACGAATTGACAAACAAATTCGGTACATCCTCGACGGCATCTCAGCCCTGAGAAAGGAGACATGTAACAAGAGTAACATGTGTGAAAGCAGCAAAGAGGCACTGGCAGAAAACAACCTGAACCTTCCAAAGATGGCTGAAAAAGATGGATGCTTCCAATCTGGATTCAATGAGGAGACTTGCCTGGTGAAAATCATCACTGGTCTTTTGGAGTTTGAGGTATACCTAGAGTACCTCCAGAACAGATTTGAGAGTAGTGAGGAACAAGCCAGAGCTGTGCAGATGAGTACAAAAGTCCTGATCCAGTTCCTGCAGAAAAAGGCAAAGAATCTAGATGCAATAACCACCCCTGACCCAACCACAAATGCCAGCCTGCTGACGAAGCTGCAGGCACAGAACCAGTGGCTGCAGGACATGACAACTCATCTCATTCTGCGCAGCTTTAAGGAGTTCCTGCAGTCCAGCCTGAGGGCTCTTCGGCAAATGTAG |
ORF Protein Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
Target ID | GM-T32578 |
Target Name | IL-6/IL6 |
Gene Group Identifier (Target Gene ID in Homo species) |
3569 |
Gene ID |
100034196 (Equus caballus), 16193 (Mus musculus), 24498 (Rattus norvegicus), 280826 (Bos taurus) 3569 (Homo sapiens), 403985 (Canis lupus familiaris), 493687 (Felis catus), 705819 (Macaca mulatta) |
Gene Symbols & Synonyms | IL6,Il6,IL-6,Il-6,ILg6,Ifnb2,CDF,HGF,HSF,BSF2,BSF-2,IFNB2,IFN-beta-2 |
Target Alternative Names | IL-6, IL6,Interleukin-6,IL-6,B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2),CDF,HGF,HSF,BSF2,IL-6,BSF-2,IFNB2,IFN-beta-2 |
Uniprot Accession |
P05231,P08505,P20607,P26892,P41323,P41683,P51494,Q95181
Additional SwissProt Accessions: Q95181,P08505,P20607,P26892,P05231,P41323,P41683,P51494 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target |
Disease | cancer, Urolithiasis, Acute kidney failure, Diabetic Nephropathy, Interstitial cystitis (chronic), Malignant neoplasm of bladder, Overactive bladder, Type 1 diabetes mellitus, Urinary bladder urothelial carcinoma, Urinary Tract Infection |
Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, Antifolate resistance, Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, HIF-1 signaling pathway, FoxO signaling pathway, PI3K-Akt signaling pathway, Cellular senescence, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Hematopoietic cell lineage, IL-17 signaling pathway, Th17 cell differentiation, TNF signaling pathway, Intestinal immune network for IgA production, Insulin resistance, AGE-RAGE signaling pathway in diabetic complications, Alcoholic liver disease, Alzheimer disease, Pathogenic Escherichia coli infection, Pertussis, Legionellosis, Yersinia infection, Chagas disease, African trypanosomiasis, Malaria, Amoebiasis, Tuberculosis, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Inflammatory bowel disease, Rheumatoid arthritis, Graft-versus-host disease, Hypertrophic cardiomyopathy, Lipid and atherosclerosis |
Gene Ensembl | ENSECAG00000016482, ENSMUSG00000025746, ENSBTAG00000014921, ENSG00000136244, ENSCAFG00845008825, ENSMMUG00000019983 |
Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.