Human HRAS/C-BAS/HAS/C-H-RAS ORF/cDNA clone-Lentivirus particle (NM_005343.3)

Cat. No.: vGMLP005796

Pre-made Human HRAS/C-BAS/HAS/C-H-RAS Lentiviral expression plasmid for HRAS lentivirus packaging, HRAS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HRAS/C-BAS/HAS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005796 Human HRAS Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005796
Gene Name HRAS
Accession Number NM_005343.3
Gene ID 3265
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 570 bp
Gene Alias C-BAS/HAS,C-H-RAS,C-HA-RAS1,c-K-ras,c-Ki-ras,CTLO,H-RASIDX,HAMSV,HRAS1,Ki-Ras,KRAS,KRAS2,p21ras,RASH1,RASK2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACGGAATATAAGCTGGTGGTGGTGGGCGCCGGCGGTGTGGGCAAGAGTGCGCTGACCATCCAGCTGATCCAGAACCATTTTGTGGACGAATACGACCCCACTATAGAGGATTCCTACCGGAAGCAGGTGGTCATTGATGGGGAGACGTGCCTGTTGGACATCCTGGATACCGCCGGCCAGGAGGAGTACAGCGCCATGCGGGACCAGTACATGCGCACCGGGGAGGGCTTCCTGTGTGTGTTTGCCATCAACAACACCAAGTCTTTTGAGGACATCCACCAGTACAGGGAGCAGATCAAACGGGTGAAGGACTCGGATGACGTGCCCATGGTGCTGGTGGGGAACAAGTGTGACCTGGCTGCACGCACTGTGGAATCTCGGCAGGCTCAGGACCTCGCCCGAAGCTACGGCATCCCCTACATCGAGACCTCGGCCAAGACCCGGCAGGGAGTGGAGGATGCCTTCTACACGTTGGTGCGTGAGATCCGGCAGCACAAGCTGCGGAAGCTGAACCCTCCTGATGAGAGTGGCCCCGGCTGCATGAGCTGCAAGTGTGTGCTCTCCTGA
ORF Protein Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T71081-Ab Anti-HRAS monoclonal antibody
    Target Antigen GM-Tg-g-T71081-Ag HRAS protein
    ORF Viral Vector pGMLP000856 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005584 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005791 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005792 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005793 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005794 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005795 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005796 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005797 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005798 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005799 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005808 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-052 Human HRas Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-192 Human HRas Adenovirus plasmid
    ORF Viral Vector vGMLP000856 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005584 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005791 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005792 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005793 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005794 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005795 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005796 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005797 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005798 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005799 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005808 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP-SPh-052 Human HRas Lentivirus particle
    ORF Viral Vector vGMAP-SPh-192 Human HRas Adenovirus particle


    Target information

    Target ID GM-T71081
    Target Name HRAS
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3265
    Gene ID 100055481 (Equus caballus), 100298939 (Bos taurus), 15461 (Mus musculus), 293621 (Rattus norvegicus)
    3265 (Homo sapiens), 403735 (Canis lupus familiaris), 698830 (Macaca mulatta), 751103 (Felis catus)
    Gene Symbols & Synonyms HRAS,Hras,H-Ras,ras,H-ras,Hras1,Kras2,Ha-ras,Hras-1,c-H-ras,c-rasHa,c-Ha-ras,Harvey-ras,HRAS1,CTLO,HAMSV,RASH1,p21ras,C-H-RAS,H-RASIDX,C-BAS/HAS,C-HA-RAS1,H-RAS
    Target Alternative Names C-BAS/HAS,C-H-RAS,C-HA-RAS1,CTLO,GTPase HRas,H-RAS,H-RASIDX,H-Ras,H-Ras-1,H-ras,HAMSV,HRAS,HRAS1,Ha-Ras,Ha-ras,Harvey-ras,Hras,Hras-1,Hras1,Kras2,RASH1,Transforming protein p21,c-H-ras,c-Ha-ras,c-rasHa,p21ras,ras
    Uniprot Accession P01112,P20171,Q61411
    Additional SwissProt Accessions: Q61411,P20171,P01112
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Non-Small Cell Lung Cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Chemokine signaling pathway, FoxO signaling pathway, Sphingolipid signaling pathway, Phospholipase D signaling pathway, PI3K-Akt signaling pathway, Apoptosis, Longevity regulating pathway, Longevity regulating pathway - multiple species, Cellular senescence, Axon guidance, Focal adhesion, Gap junction, Signaling pathways regulating pluripotency of stem cells, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Long-term potentiation, Neurotrophin signaling pathway, Cholinergic synapse, Serotonergic synapse, Regulation of actin cytoskeleton, GnRH signaling pathway, Melanogenesis, Prolactin signaling pathway, Thyroid hormone signaling pathway, Oxytocin signaling pathway, Relaxin signaling pathway, GnRH secretion, AGE-RAGE signaling pathway in diabetic complications, Growth hormone synthesis, secretion and action, Alzheimer disease, Hepatitis C, Hepatitis B, Human cytomegalovirus infection, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Renal cell carcinoma, Endometrial cancer, Glioma, Prostate cancer, Thyroid cancer, Melanoma, Bladder cancer, Chronic myeloid leukemia, Acute myeloid leukemia, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer, Central carbon metabolism in cancer, Choline metabolism in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Lipid and atherosclerosis
    Gene Ensembl ENSBTAG00000046644, ENSMUSG00000025499, ENSG00000174775, ENSCAFG00845029661, ENSMMUG00000021659
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.