Human RHOA/ARH12/ARHA ORF/cDNA clone-Lentivirus particle (NM_001313941.1)

Cat. No.: vGMLP005662

Pre-made Human RHOA/ARH12/ARHA Lentiviral expression plasmid for RHOA lentivirus packaging, RHOA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RHOA/ARH12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005662 Human RHOA Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005662
Gene Name RHOA
Accession Number NM_001313941.1
Gene ID 387
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 582 bp
Gene Alias ARH12,ARHA,RHO12,RHOH12
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGTAGAGTTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGCCTGAGGCCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGCCCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCCAACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGGCGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGAGAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAATCTGGGTGCCTTGTCTTGTGA
ORF Protein Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T96736-Ab Anti-RHOA/ ARH12/ ARHA monoclonal antibody
    Target Antigen GM-Tg-g-T96736-Ag RHOA VLP (virus-like particle)
    ORF Viral Vector pGMLP005662 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMLV000967 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMLV001080 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMLV001496 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMAP000445 Human RHOA Adenovirus plasmid
    ORF Viral Vector pGMAP000543 Human RHOA Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-067 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-207 Human RHOA Adenovirus plasmid
    ORF Viral Vector pGMPC000595 Human RHOA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001816 Human RHOA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005662 Human RHOA Lentivirus particle
    ORF Viral Vector vGMLV000967 Human RHOA Lentivirus particle
    ORF Viral Vector vGMLV001080 Human RHOA Lentivirus particle
    ORF Viral Vector vGMLV001496 Human RHOA Lentivirus particle
    ORF Viral Vector vGMAP000445 Human RHOA Adenovirus particle
    ORF Viral Vector vGMAP000543 Human RHOA Adenovirus particle
    ORF Viral Vector vGMLP-SPh-067 Human RHOA Lentivirus particle
    ORF Viral Vector vGMAP-SPh-207 Human RHOA Adenovirus particle


    Target information

    Target ID GM-T96736
    Target Name RHOA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    387
    Gene ID 100053343 (Equus caballus), 101084011 (Felis catus), 117273 (Rattus norvegicus), 11848 (Mus musculus)
    338049 (Bos taurus), 387 (Homo sapiens), 403954 (Canis lupus familiaris), 706455 (Macaca mulatta)
    Gene Symbols & Synonyms RHOA,Rhoa,Arha,Arha2,Arha1,ARHA,ARH12,RHO12,EDFAOB,RHOH12,RHO1
    Target Alternative Names ARH12,ARHA,Arha,Arha1,Arha2,EDFAOB,RHO1,RHO12,RHOA,RHOH12,Rho cDNA clone 12 (h12),Rhoa,Transforming protein RhoA
    Uniprot Accession P24406,P61585,P61586,P61589,Q9QUI0
    Additional SwissProt Accessions: P61589,Q9QUI0,P61585,P61586,P24406
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, Breast Cancer
    Disease from KEGG Ras signaling pathway, Rap1 signaling pathway, cGMP-PKG signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Sphingolipid signaling pathway, Phospholipase D signaling pathway, Vascular smooth muscle contraction, Wnt signaling pathway, TGF-beta signaling pathway, Axon guidance, Focal adhesion, Adherens junction, Tight junction, Platelet activation, NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, T cell receptor signaling pathway, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Parathyroid hormone synthesis, secretion and action, Pancreatic secretion, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Tuberculosis, Human cytomegalovirus infection, Pathways in cancer, Proteoglycans in cancer, Colorectal cancer, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000033791, ENSMUSG00000007815, ENSBTAG00000004279, ENSG00000067560, ENSCAFG00845026916, ENSMMUG00000047476
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.