Human RHOC/ARH9/ARHC ORF/cDNA clone-Lentivirus particle (NM_175744.4)

Cat. No.: vGMLP005660

Pre-made Human RHOC/ARH9/ARHC Lentiviral expression plasmid for RHOC lentivirus packaging, RHOC lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RHOC/RhoC/RHOC/ARH9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005660 Human RHOC Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005660
Gene Name RHOC
Accession Number NM_175744.4
Gene ID 389
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 582 bp
Gene Alias ARH9,ARHC,H9,RHOH9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCAATCCGAAAGAAGCTGGTGATCGTTGGGGATGGTGCCTGTGGGAAGACCTGCCTCCTCATCGTCTTCAGCAAGGATCAGTTTCCGGAGGTCTACGTCCCTACTGTCTTTGAGAACTATATTGCGGACATTGAGGTGGACGGCAAGCAGGTGGAGCTGGCTCTGTGGGACACAGCAGGGCAGGAAGACTATGATCGACTGCGGCCTCTCTCCTACCCGGACACTGATGTCATCCTCATGTGCTTCTCCATCGACAGCCCTGACAGCCTGGAAAACATTCCTGAGAAGTGGACCCCAGAGGTGAAGCACTTCTGCCCCAACGTGCCCATCATCCTGGTGGGGAATAAGAAGGACCTGAGGCAAGACGAGCACACCAGGAGAGAGCTGGCCAAGATGAAGCAGGAGCCCGTTCGGTCTGAGGAAGGCCGGGACATGGCGAACCGGATCAGTGCCTTTGGCTACCTTGAGTGCTCAGCCAAGACCAAGGAGGGAGTGCGGGAGGTGTTTGAGATGGCCACTCGGGCTGGCCTCCAGGTCCGCAAGAACAAGCGTCGGAGGGGCTGTCCCATTCTCTGA
ORF Protein Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO127-Ab Anti-RhoC monoclonal antibody
    Target Antigen GM-Tg-g-IO127-Ag RhoC/RHOC protein
    ORF Viral Vector pGMLP004158 Human RHOC Lentivirus plasmid
    ORF Viral Vector pGMLP005660 Human RHOC Lentivirus plasmid
    ORF Viral Vector vGMLP004158 Human RHOC Lentivirus particle
    ORF Viral Vector vGMLP005660 Human RHOC Lentivirus particle


    Target information

    Target ID GM-IO127
    Target Name RHOC/RhoC
    Gene Group Identifier
    （Target Gene ID in Homo species)         		389
    Gene ID 100146263 (Equus caballus), 101098319 (Felis catus), 11853 (Mus musculus), 295342 (Rattus norvegicus)
    389 (Homo sapiens), 483218 (Canis lupus familiaris), 513152 (Bos taurus), 706034 (Macaca mulatta)
    Gene Symbols & Synonyms RHOC,Rhoc,Arh9,Arhc,H9,ARH9,ARHC,RHOH9
    Target Alternative Names ARH9,ARHC,Arh9,Arhc,H9,RHOC,RHOH9,Rho cDNA clone 9 (h9),Rho-related GTP-binding protein RhoC,RhoC,Rhoc
    Uniprot Accession P08134,Q1RMJ6,Q62159
    Additional SwissProt Accessions: Q62159,P08134,Q1RMJ6
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000044625, ENSMUSG00000002233, ENSG00000155366, ENSCAFG00845006667, ENSBTAG00000014299, ENSMMUG00000007767
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.