Human CDK4/CMM3/PSK-J3 ORF/cDNA clone-Lentivirus particle (NM_000075.3)

Cat. No.: vGMLP005615

Pre-made Human CDK4/CMM3/PSK-J3 Lentiviral expression plasmid for CDK4 lentivirus packaging, CDK4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CDK4/CMM3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005615 Human CDK4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005615
Gene Name CDK4
Accession Number NM_000075.3
Gene ID 1019
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 912 bp
Gene Alias CMM3,PSK-J3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTACCTCTCGATATGAGCCAGTGGCTGAAATTGGTGTCGGTGCCTATGGGACAGTGTACAAGGCCCGTGATCCCCACAGTGGCCACTTTGTGGCCCTCAAGAGTGTGAGAGTCCCCAATGGAGGAGGAGGTGGAGGAGGCCTTCCCATCAGCACAGTTCGTGAGGTGGCTTTACTGAGGCGACTGGAGGCTTTTGAGCATCCCAATGTTGTCCGGCTGATGGACGTCTGTGCCACATCCCGAACTGACCGGGAGATCAAGGTAACCCTGGTGTTTGAGCATGTAGACCAGGACCTAAGGACATATCTGGACAAGGCACCCCCACCAGGCTTGCCAGCCGAAACGATCAAGGATCTGATGCGCCAGTTTCTAAGAGGCCTAGATTTCCTTCATGCCAATTGCATCGTTCACCGAGATCTGAAGCCAGAGAACATTCTGGTGACAAGTGGTGGAACAGTCAAGCTGGCTGACTTTGGCCTGGCCAGAATCTACAGCTACCAGATGGCACTTACACCCGTGGTTGTTACACTCTGGTACCGAGCTCCCGAAGTTCTTCTGCAGTCCACATATGCAACACCTGTGGACATGTGGAGTGTTGGCTGTATCTTTGCAGAGATGTTTCGTCGAAAGCCTCTCTTCTGTGGAAACTCTGAAGCCGACCAGTTGGGCAAAATCTTTGACCTGATTGGGCTGCCTCCAGAGGATGACTGGCCTCGAGATGTATCCCTGCCCCGTGGAGCCTTTCCCCCCAGAGGGCCCCGCCCAGTGCAGTCGGTGGTACCTGAGATGGAGGAGTCGGGAGCACAGCTGCTGCTGGAAATGCTGACTTTTAACCCACACAAGCGAATCTCTGCCTTTCGAGCTCTGCAGCACTCTTATCTACATAAGGATGAAGGTAATCCGGAGTGA
ORF Protein Sequence MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85799-Ab Anti-CDK4 monoclonal antibody
    Target Antigen GM-Tg-g-T85799-Ag CDK4 protein
    ORF Viral Vector pGMLP005426 Human CDK4 Lentivirus plasmid
    ORF Viral Vector pGMLP005615 Human CDK4 Lentivirus plasmid
    ORF Viral Vector pGMLV000900 Human CDK4 Lentivirus plasmid
    ORF Viral Vector pGMAP000163 Human CDK4 Adenovirus plasmid
    ORF Viral Vector vGMLP005426 Human CDK4 Lentivirus particle
    ORF Viral Vector vGMLP005615 Human CDK4 Lentivirus particle
    ORF Viral Vector vGMLV000900 Human CDK4 Lentivirus particle
    ORF Viral Vector vGMAP000163 Human CDK4 Adenovirus particle


    Target information

    Target ID GM-T85799
    Target Name CDK4
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1019
    Gene ID 100051005 (Equus caballus), 101097903 (Felis catus), 1019 (Homo sapiens), 12567 (Mus musculus)
    481131 (Canis lupus familiaris), 510618 (Bos taurus), 715650 (Macaca mulatta), 94201 (Rattus norvegicus)
    Gene Symbols & Synonyms CDK4,Cdk4,CMM3,PSK-J3,Crk3
    Target Alternative Names CDK4,CMM3,Cdk4,Cell division protein kinase 4,Crk3,Cyclin-dependent kinase 4,PSK-J3
    Uniprot Accession P11802,P30285,P35426,Q32KY4
    Additional SwissProt Accessions: P11802,P30285,Q32KY4,P35426
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Non-Small Cell Lung Cancer
    Disease from KEGG Endocrine resistance, p53 signaling pathway, PI3K-Akt signaling pathway, Cellular senescence, Tight junction, T cell receptor signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Cushing syndrome, Hepatitis C, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Pancreatic cancer, Glioma, Melanoma, Bladder cancer, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma
    Gene Ensembl ENSECAG00000025015, ENSG00000135446, ENSMUSG00000006728, ENSCAFG00845013840, ENSBTAG00000007160, ENSMMUG00000023694
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.