Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CCND3 ORF/cDNA clone-Lentivirus particle (NM_001760.4)
Cat. No.: vGMLP005614
Pre-made Human CCND3/ Lentiviral expression plasmid for CCND3 lentivirus packaging, CCND3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
Cyclin D3/CCND3/CCND3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP005614 | Human CCND3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP005614 |
| Gene Name | CCND3 |
| Accession Number | NM_001760.4 |
| Gene ID | 896 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 879 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGCTGCTGTGTTGCGAAGGCACCCGGCACGCGCCCCGGGCCGGGCCGGACCCGCGGCTGCTGGGGGACCAGCGTGTCCTGCAGAGCCTGCTCCGCCTGGAGGAGCGCTACGTACCCCGCGCCTCCTACTTCCAGTGCGTGCAGCGGGAGATCAAGCCGCACATGCGGAAGATGCTGGCTTACTGGATGCTGGAGGTATGTGAGGAGCAGCGCTGTGAGGAGGAAGTCTTCCCCCTGGCCATGAACTACCTGGATCGCTACCTGTCTTGCGTCCCCACCCGAAAGGCGCAGTTGCAGCTCCTGGGTGCGGTCTGCATGCTGCTGGCCTCCAAGCTGCGCGAGACCACGCCCCTGACCATCGAAAAACTGTGCATCTACACCGACCACGCTGTCTCTCCCCGCCAGTTGCGGGACTGGGAGGTGCTGGTCCTAGGGAAGCTCAAGTGGGACCTGGCTGCTGTGATTGCACATGATTTCCTGGCCTTCATTCTGCACCGGCTCTCTCTGCCCCGTGACCGACAGGCCTTGGTCAAAAAGCATGCCCAGACCTTTTTGGCCCTCTGTGCTACAGATTATACCTTTGCCATGTACCCGCCATCCATGATCGCCACGGGCAGCATTGGGGCTGCAGTGCAAGGCCTGGGTGCCTGCTCCATGTCCGGGGATGAGCTCACAGAGCTGCTGGCAGGGATCACTGGCACTGAAGTGGACTGCCTGCGGGCCTGTCAGGAGCAGATCGAAGCTGCACTCAGGGAGAGCCTCAGGGAAGCCTCTCAGACCAGCTCCAGCCCAGCGCCCAAAGCCCCCCGGGGCTCCAGCAGCCAAGGGCCCAGCCAGACCAGCACTCCTACAGATGTCACAGCCATACACCTGTAG |
| ORF Protein Sequence | MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T72507-Ab | Anti-CCND3 monoclonal antibody |
| Target Antigen | GM-Tg-g-T72507-Ag | CCND3 protein |
| ORF Viral Vector | pGMLP000470 | Human CCND3 Lentivirus plasmid |
| ORF Viral Vector | pGMLP005614 | Human CCND3 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000364 | Human CCND3 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000470 | Human CCND3 Lentivirus particle |
| ORF Viral Vector | vGMLP005614 | Human CCND3 Lentivirus particle |
| ORF Viral Vector | vGMAP000364 | Human CCND3 Adenovirus particle |
Target information
| Target ID | GM-T72507 |
| Target Name | Cyclin D3/CCND3 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
896 |
| Gene ID |
100066590 (Equus caballus), 101101311 (Felis catus), 12445 (Mus musculus), 25193 (Rattus norvegicus) 540547 (Bos taurus), 608847 (Canis lupus familiaris), 695215 (Macaca mulatta), 896 (Homo sapiens) |
| Gene Symbols & Synonyms | CCND3,Ccnd3,9230106B05Rik |
| Target Alternative Names | 9230106B05Rik,CCND3,Ccnd3,Cyclin D3,G1/S-specific cyclin-D3 |
| Uniprot Accession |
P30281,P30282,P48961,Q3MHH5
Additional SwissProt Accessions: P30282,P48961,Q3MHH5,P30281 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | p53 signaling pathway, PI3K-Akt signaling pathway, Cellular senescence, Wnt signaling pathway, Hippo signaling pathway, Focal adhesion, JAK-STAT signaling pathway, Measles, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, Pathways in cancer, Chemical carcinogenesis - receptor activation |
| Gene Ensembl | ENSECAG00000023862, ENSMUSG00000034165, ENSBTAG00000010106, ENSCAFG00845016058, ENSMMUG00000004419, ENSG00000112576 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.