Human SPRY3/spry-3 ORF/cDNA clone-Lentivirus particle (NM_001304990.1)

Cat. No.: vGMLP005605

Pre-made Human SPRY3/spry-3 Lentiviral expression plasmid for SPRY3 lentivirus packaging, SPRY3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SPRY3/spry-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005605 Human SPRY3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005605
Gene Name SPRY3
Accession Number NM_001304990.1
Gene ID 10251
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 867 bp
Gene Alias spry-3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATGCTGCGGTGACAGATGATTTTCAACAAATTCTGCCTATTGAACAGCTGCGCTCTACTCATGCTAGCAATGACTACGTGGAACGGCCTCCAGCCCCCTGTAAACAGGCCCTCTCCAGCCCTTCCCTTATTGTGCAAACCCACAAGTCTGATTGGTCTCTGGCTACCATGCCTACTTCTCTCCCCCGCAGTCTCAGCCAGTGCCATCAACTGCAGCCCTTGCCTCAGCATCTGAGCCAATCTAGCATTGCCAGCTCAATGTCCCATAGCACCACTGCCTCTGATCAAAGGCTCTTGGCCAGCATTACACCCTCACCTTCAGGCCAATCCATCATCCGAACCCAACCTGGAGCAGGGGTCCACCCAAAGGCTGATGGTGCTCTGAAGGGAGAAGCTGAGCAATCTGCAGGGCACCCTAGTGAGCACCTCTTCATCTGTGAGGAATGTGGGCGCTGCAAGTGCGTCCCCTGCACAGCAGCTCGCCCTCTCCCCTCCTGCTGGCTGTGCAACCAGCGCTGCCTTTGCTCTGCTGAGAGCCTCCTCGATTATGGCACTTGTCTCTGCTGTGTCAAGGGCCTCTTCTACCACTGCTCCACTGATGATGAAGACAACTGTGCTGATGAGCCCTGCTCTTGTGGGCCTAGTTCTTGCTTTGTCCGCTGGGCAGCCATGAGCCTCATCTCCCTCTTCCTACCCTGCCTGTGCTGCTACCTGCCTACCCGTGGATGCCTCCATCTGTGCCAACAGGGCTATGATAGCCTCCGGCGACCAGGCTGCCGCTGCAAGAGGCACACCAACACTGTGTGCAGAAAGATCTCTTCTGGTAGTGCACCCTTCCCCAAGGCCCAGGAAAAGTCTGTATGA
ORF Protein Sequence MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHPSEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1814-Ab Anti-SPRY3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1814-Ag SPRY3 protein
    Cytokine cks-Tg-g-GM-IP1814 sprouty homolog 3 (Drosophila) (SPRY3) protein & antibody
    ORF Viral Vector pGMLP005605 Human SPRY3 Lentivirus plasmid
    ORF Viral Vector vGMLP005605 Human SPRY3 Lentivirus particle


    Target information

    Target ID GM-IP1814
    Target Name SPRY3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10251
    Gene ID 100062480 (Equus caballus), 101094659 (Felis catus), 10251 (Homo sapiens), 236576 (Mus musculus)
    492271 (Canis lupus familiaris), 498159 (Rattus norvegicus), 539402 (Bos taurus), 703923 (Macaca mulatta)
    Gene Symbols & Synonyms SPRY3,Spry3,spry-3,Gm391,Gm1409,sprouty3,RGD1562172
    Target Alternative Names Gm1409,Gm391,Protein sprouty homolog 3,RGD1562172,SPRY3,Sprouty RTK signaling antagonist 3,Sprouty3,Spry-3,Spry3,sprouty3,spry-3
    Uniprot Accession O43610,Q3UUD2
    Additional SwissProt Accessions: O43610,Q3UUD2
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Cytokine Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000058224, ENSG00000168939, ENSCAFG00845018191, ENSBTAG00000067551, ENSMMUG00000051319
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.