Human FOS/AP-1/C-FOS ORF/cDNA clone-Lentivirus particle (NM_005252.3)

Cat. No.: vGMLP005582

Pre-made Human FOS/AP-1/C-FOS Lentiviral expression plasmid for FOS lentivirus packaging, FOS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to c-Fos/FOS/FOS/AP-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005582 Human FOS Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005582
Gene Name FOS
Accession Number NM_005252.3
Gene ID 2353
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1143 bp
Gene Alias AP-1,C-FOS,p55
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGTTCTCGGGCTTCAACGCAGACTACGAGGCGTCATCCTCCCGCTGCAGCAGCGCGTCCCCGGCCGGGGATAGCCTCTCTTACTACCACTCACCCGCAGACTCCTTCTCCAGCATGGGCTCGCCTGTCAACGCGCAGGACTTCTGCACGGACCTGGCCGTCTCCAGTGCCAACTTCATTCCCACGGTCACTGCCATCTCGACCAGTCCGGACCTGCAGTGGCTGGTGCAGCCCGCCCTCGTCTCCTCCGTGGCCCCATCGCAGACCAGAGCCCCTCACCCTTTCGGAGTCCCCGCCCCCTCCGCTGGGGCTTACTCCAGGGCTGGCGTTGTGAAGACCATGACAGGAGGCCGAGCGCAGAGCATTGGCAGGAGGGGCAAGGTGGAACAGTTATCTCCAGAAGAAGAAGAGAAAAGGAGAATCCGAAGGGAAAGGAATAAGATGGCTGCAGCCAAATGCCGCAACCGGAGGAGGGAGCTGACTGATACACTCCAAGCGGAGACAGACCAACTAGAAGATGAGAAGTCTGCTTTGCAGACCGAGATTGCCAACCTGCTGAAGGAGAAGGAAAAACTAGAGTTCATCCTGGCAGCTCACCGACCTGCCTGCAAGATCCCTGATGACCTGGGCTTCCCAGAAGAGATGTCTGTGGCTTCCCTTGATCTGACTGGGGGCCTGCCAGAGGTTGCCACCCCGGAGTCTGAGGAGGCCTTCACCCTGCCTCTCCTCAATGACCCTGAGCCCAAGCCCTCAGTGGAACCTGTCAAGAGCATCAGCAGCATGGAGCTGAAGACCGAGCCCTTTGATGACTTCCTGTTCCCAGCATCATCCAGGCCCAGTGGCTCTGAGACAGCCCGCTCCGTGCCAGACATGGACCTATCTGGGTCCTTCTATGCAGCAGACTGGGAGCCTCTGCACAGTGGCTCCCTGGGGATGGGGCCCATGGCCACAGAGCTGGAGCCCCTGTGCACTCCGGTGGTCACCTGTACTCCCAGCTGCACTGCTTACACGTCTTCCTTCGTCTTCACCTACCCCGAGGCTGACTCCTTCCCCAGCTGTGCAGCTGCCCACCGCAAGGGCAGCAGCAGCAATGAGCCTTCCTCTGACTCGCTCAGCTCACCCACGCTGCTGGCCCTGTGA
ORF Protein Sequence MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T28025-Ab Anti-c-Fos monoclonal antibody
    Target Antigen GM-Tg-g-T28025-Ag c-Fos/FOS protein
    ORF Viral Vector pGMLP001940 Human FOS Lentivirus plasmid
    ORF Viral Vector pGMLP005582 Human FOS Lentivirus plasmid
    ORF Viral Vector pGMAD000494 Human FOS Adenovirus plasmid
    ORF Viral Vector pGMAD001430 Human FOS Adenovirus plasmid
    ORF Viral Vector pGMAP000475 Human FOS Adenovirus plasmid
    ORF Viral Vector vGMLP001940 Human FOS Lentivirus particle
    ORF Viral Vector vGMLP005582 Human FOS Lentivirus particle
    ORF Viral Vector vGMAD000494 Human FOS Adenovirus particle
    ORF Viral Vector vGMAD001430 Human FOS Adenovirus particle
    ORF Viral Vector vGMAP000475 Human FOS Adenovirus particle


    Target information

    Target ID GM-T28025
    Target Name c-Fos/FOS
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2353
    Gene ID 100051632 (Equus caballus), 14281 (Mus musculus), 2353 (Homo sapiens), 280795 (Bos taurus)
    314322 (Rattus norvegicus), 490792 (Canis lupus familiaris), 493935 (Felis catus), 702077 (Macaca mulatta)
    Gene Symbols & Synonyms FOS,Fos,cFos,c-fos,D12Rfj1,p55,AP-1,C-FOS
    Target Alternative Names AP-1,AP-1 transcription factor subunit,C-FOS,Cellular oncogene fos,D12Rfj1,FOS,Fos,Fos proto-oncogene,G0/G1 switch regulatory protein 7,Protein c-Fos,Proto-oncogene c-Fos,Transcription factor AP-1 subunit c-Fos,c-Fos,c-fos,cFos,p55
    Uniprot Accession O77628,P01100,P01101,P12841,Q8HZP6
    Additional SwissProt Accessions: P01101,P01100,O77628,P12841,Q8HZP6
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Endocrine resistance, MAPK signaling pathway, cAMP signaling pathway, Apoptosis, Osteoclast differentiation, Toll-like receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, TNF signaling pathway, Circadian entrainment, Cholinergic synapse, Prolactin signaling pathway, Oxytocin signaling pathway, Relaxin signaling pathway, Parathyroid hormone synthesis, secretion and action, Growth hormone synthesis, secretion and action, Amphetamine addiction, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, Hepatitis B, Measles, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Breast cancer, Choline metabolism in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Rheumatoid arthritis, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000014260, ENSMUSG00000021250, ENSG00000170345, ENSBTAG00000004322, ENSCAFG00845015304, ENSMMUG00000040100
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.