Human WNT1/BMND16/INT1 ORF/cDNA clone-Lentivirus particle (NM_005430.3)

Cat. No.: vGMLP005580

Pre-made Human WNT1/BMND16/INT1 Lentiviral expression plasmid for WNT1 lentivirus packaging, WNT1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to WNT1/BMND16 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005580 Human WNT1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005580
Gene Name WNT1
Accession Number NM_005430.3
Gene ID 7471
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1113 bp
Gene Alias BMND16,INT1,OI15
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCTCTGGGCGCTGTTGCCTGGCTGGGTTTCTGCTACGCTGCTGCTGGCGCTGGCCGCTCTGCCCGCAGCCCTGGCTGCCAACAGCAGTGGCCGATGGTGGGGTATTGTGAACGTAGCCTCCTCCACGAACCTGCTTACAGACTCCAAGAGTCTGCAACTGGTACTCGAGCCCAGTCTGCAGCTGTTGAGCCGCAAACAGCGGCGTCTGATACGCCAAAATCCGGGGATCCTGCACAGCGTGAGTGGGGGGCTGCAGAGTGCCGTGCGCGAGTGCAAGTGGCAGTTCCGGAATCGCCGCTGGAACTGTCCCACTGCTCCAGGGCCCCACCTCTTCGGCAAGATCGTCAACCGAGGCTGTCGAGAAACGGCGTTTATCTTCGCTATCACCTCCGCCGGGGTCACCCATTCGGTGGCGCGCTCCTGCTCAGAAGGTTCCATCGAATCCTGCACGTGTGACTACCGGCGGCGCGGCCCCGGGGGCCCCGACTGGCACTGGGGGGGCTGCAGCGACAACATTGACTTCGGCCGCCTCTTCGGCCGGGAGTTCGTGGACTCCGGGGAGAAGGGGCGGGACCTGCGCTTCCTCATGAACCTTCACAACAACGAGGCAGGCCGTACGACCGTATTCTCCGAGATGCGCCAGGAGTGCAAGTGCCACGGGATGTCCGGCTCATGCACGGTGCGCACGTGCTGGATGCGGCTGCCCACGCTGCGCGCCGTGGGCGATGTGCTGCGCGACCGCTTCGACGGCGCCTCGCGCGTCCTGTACGGCAACCGCGGCAGCAACCGCGCTTCGCGGGCGGAGCTGCTGCGCCTGGAGCCGGAAGACCCGGCCCACAAACCGCCCTCCCCCCACGACCTCGTCTACTTCGAGAAATCGCCCAACTTCTGCACGTACAGCGGACGCCTGGGCACAGCAGGCACGGCAGGGCGCGCCTGTAACAGCTCGTCGCCCGCGCTGGACGGCTGCGAGCTGCTCTGCTGCGGCAGGGGCCACCGCACGCGCACGCAGCGCGTCACCGAGCGCTGCAACTGCACCTTCCACTGGTGCTGCCACGTCAGCTGCCGCAACTGCACGCACACGCGCGTACTGCACGAGTGTCTGTGA
ORF Protein Sequence MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1934-Ab Anti-WNT1/ BMND16/ INT1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1934-Ag WNT1 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-MP1934 wingless-type MMTV integration site family, member 1 (WNT1) protein & antibody
    ORF Viral Vector pGMLP002016 Human WNT1 Lentivirus plasmid
    ORF Viral Vector pGMLP005580 Human WNT1 Lentivirus plasmid
    ORF Viral Vector pGMAD000604 Human WNT1 Adenovirus plasmid
    ORF Viral Vector vGMLP002016 Human WNT1 Lentivirus particle
    ORF Viral Vector vGMLP005580 Human WNT1 Lentivirus particle
    ORF Viral Vector vGMAD000604 Human WNT1 Adenovirus particle


    Target information

    Target ID GM-MP1934
    Target Name WNT1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7471
    Gene ID 100058859 (Equus caballus), 101094190 (Felis catus), 22408 (Mus musculus), 24881 (Rattus norvegicus)
    486560 (Canis lupus familiaris), 540662 (Bos taurus), 709009 (Macaca mulatta), 7471 (Homo sapiens)
    Gene Symbols & Synonyms WNT1,Wnt1,sw,Int-1,Wnt-1,swaying,Int1,INT1,OI15,BMND16
    Target Alternative Names BMND16,INT1,Int-1,Int1,OI15,Proto-oncogene Int-1 homolog,Proto-oncogene Wnt-1,WNT1,Wnt-1,Wnt1,sw,swaying
    Uniprot Accession P04426,P04628
    Additional SwissProt Accessions: P04426,P04628
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Cytokine Target
    Disease cancer
    Disease from KEGG Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Alzheimer disease, Human papillomavirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer
    Gene Ensembl ENSECAG00000009064, ENSMUSG00000022997, ENSCAFG00845022557, ENSBTAG00000015364, ENSMMUG00000015709, ENSG00000125084
    Target Classification Pathway, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.