Human WNT7B ORF/cDNA clone-Lentivirus particle (NM_058238.2)
Cat. No.: vGMLP005572
Pre-made Human WNT7B/ Lentiviral expression plasmid for WNT7B lentivirus packaging, WNT7B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
WNT7B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP005572 | Human WNT7B Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP005572 |
| Gene Name | WNT7B |
| Accession Number | NM_058238.2 |
| Gene ID | 7477 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 1050 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCACAGAAACTTTCGCAAGTGGATTTTCTACGTGTTTCTCTGCTTTGGCGTCCTGTACGTGAAGCTCGGAGCACTGTCATCCGTGGTGGCCCTGGGAGCCAACATCATCTGCAACAAGATTCCTGGCCTAGCCCCGCGGCAGCGTGCCATCTGCCAGAGTCGGCCCGATGCCATCATTGTGATTGGGGAGGGGGCGCAGATGGGCATCAACGAGTGCCAGTACCAGTTCCGCTTCGGACGCTGGAACTGCTCTGCCCTCGGCGAGAAGACCGTCTTCGGGCAAGAGCTCCGAGTAGGGAGCCGTGAGGCTGCCTTCACGTACGCCATCACCGCGGCTGGCGTGGCGCACGCCGTCACCGCTGCCTGCAGCCAAGGGAACCTGAGCAACTGCGGCTGCGACCGCGAGAAGCAGGGCTACTACAACCAAGCCGAGGGCTGGAAGTGGGGCGGCTGCTCGGCCGACGTGCGTTACGGCATCGACTTCTCCCGGCGCTTCGTGGACGCTCGGGAGATCAAGAAGAACGCGCGGCGCCTCATGAACCTGCATAACAATGAGGCCGGCAGGAAGGTTCTAGAGGACCGGATGCAGCTGGAGTGCAAGTGCCACGGCGTGTCTGGCTCCTGCACCACCAAAACCTGCTGGACCACGCTGCCCAAGTTCCGAGAGGTGGGCCACCTGCTGAAGGAGAAGTACAACGCGGCCGTGCAGGTGGAGGTGGTGCGGGCCAGCCGTCTGCGGCAGCCCACCTTCCTGCGCATCAAACAGCTGCGCAGCTATCAGAAGCCCATGGAGACAGACCTGGTGTACATTGAGAAGTCGCCCAACTACTGCGAGGAGGACGCGGCCACGGGCAGCGTGGGCACGCAGGGCCGTCTCTGCAACCGCACGTCGCCCGGCGCGGACGGCTGTGACACCATGTGCTGCGGCCGAGGCTACAACACCCACCAGTACACCAAGGTGTGGCAGTGCAACTGCAAATTCCACTGGTGCTGCTTCGTCAAGTGCAACACCTGCAGCGAGCGCACCGAGGTCTTCACCTGCAAGTGA |
| ORF Protein Sequence | MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP1939-Ab | Anti-WNT7B monoclonal antibody |
| Target Antigen | GM-Tg-g-MP1939-Ag | WNT7B VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-MP1939 | wingless-type MMTV integration site family, member 7B (WNT7B) protein & antibody |
| ORF Viral Vector | pGMLP005572 | Human WNT7B Lentivirus plasmid |
| ORF Viral Vector | pGMPC000004 | Human WNT7B Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP005572 | Human WNT7B Lentivirus particle |
Target information
| Target ID | GM-MP1939 |
| Target Name | WNT7B |
|
Gene Group Identifier (Target Gene ID in Homo species) |
7477 |
| Gene ID |
100053027 (Equus caballus), 100337066 (Bos taurus), 101095592 (Felis catus), 22422 (Mus musculus) 315196 (Rattus norvegicus), 481206 (Canis lupus familiaris), 713864 (Macaca mulatta), 7477 (Homo sapiens) |
| Gene Symbols & Synonyms | WNT7B,Wnt7b,Wnt-7b |
| Target Alternative Names | Protein Wnt-7b,WNT7B,Wnt-7b,Wnt7b |
| Uniprot Accession |
P28047,P56706
Additional SwissProt Accessions: P28047,P56706 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Cytokine Target |
| Disease | |
| Disease from KEGG | Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Alzheimer disease, Human papillomavirus infection, Pathways in cancer, Proteoglycans in cancer, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer |
| Gene Ensembl | ENSECAG00000013387, ENSBTAG00000048365, ENSMUSG00000022382, ENSCAFG00845010609, ENSMMUG00000000180, ENSG00000188064 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


