Human CDK4/CMM3/PSK-J3 ORF/cDNA clone-Lentivirus particle (NM_000075.3)
Cat. No.: vGMLP005426
Pre-made Human CDK4/CMM3/PSK-J3 Lentiviral expression plasmid for CDK4 lentivirus packaging, CDK4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CDK4/CMM3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP005426 | Human CDK4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP005426 |
| Gene Name | CDK4 |
| Accession Number | NM_000075.3 |
| Gene ID | 1019 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 912 bp |
| Gene Alias | CMM3,PSK-J3 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTACCTCTCGATATGAGCCAGTGGCTGAAATTGGTGTCGGTGCCTATGGGACAGTGTACAAGGCCCGTGATCCCCACAGTGGCCACTTTGTGGCCCTCAAGAGTGTGAGAGTCCCCAATGGAGGAGGAGGTGGAGGAGGCCTTCCCATCAGCACAGTTCGTGAGGTGGCTTTACTGAGGCGACTGGAGGCTTTTGAGCATCCCAATGTTGTCCGGCTGATGGACGTCTGTGCCACATCCCGAACTGACCGGGAGATCAAGGTAACCCTGGTGTTTGAGCATGTAGACCAGGACCTAAGGACATATCTGGACAAGGCACCCCCACCAGGCTTGCCAGCCGAAACGATCAAGGATCTGATGCGCCAGTTTCTAAGAGGCCTAGATTTCCTTCATGCCAATTGCATCGTTCACCGAGATCTGAAGCCAGAGAACATTCTGGTGACAAGTGGTGGAACAGTCAAGCTGGCTGACTTTGGCCTGGCCAGAATCTACAGCTACCAGATGGCACTTACACCCGTGGTTGTTACACTCTGGTACCGAGCTCCCGAAGTTCTTCTGCAGTCCACATATGCAACACCTGTGGACATGTGGAGTGTTGGCTGTATCTTTGCAGAGATGTTTCGTCGAAAGCCTCTCTTCTGTGGAAACTCTGAAGCCGACCAGTTGGGCAAAATCTTTGACCTGATTGGGCTGCCTCCAGAGGATGACTGGCCTCGAGATGTATCCCTGCCCCGTGGAGCCTTTCCCCCCAGAGGGCCCCGCCCAGTGCAGTCGGTGGTACCTGAGATGGAGGAGTCGGGAGCACAGCTGCTGCTGGAAATGCTGACTTTTAACCCACACAAGCGAATCTCTGCCTTTCGAGCTCTGCAGCACTCTTATCTACATAAGGATGAAGGTAATCCGGAGTGA |
| ORF Protein Sequence | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T85799-Ab | Anti-CDK4 monoclonal antibody |
| Target Antigen | GM-Tg-g-T85799-Ag | CDK4 protein |
| ORF Viral Vector | pGMLP005426 | Human CDK4 Lentivirus plasmid |
| ORF Viral Vector | pGMLP005615 | Human CDK4 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000900 | Human CDK4 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000163 | Human CDK4 Adenovirus plasmid |
| ORF Viral Vector | vGMLP005426 | Human CDK4 Lentivirus particle |
| ORF Viral Vector | vGMLP005615 | Human CDK4 Lentivirus particle |
| ORF Viral Vector | vGMLV000900 | Human CDK4 Lentivirus particle |
| ORF Viral Vector | vGMAP000163 | Human CDK4 Adenovirus particle |
Target information
| Target ID | GM-T85799 |
| Target Name | CDK4 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
1019 |
| Gene ID |
100051005 (Equus caballus), 101097903 (Felis catus), 1019 (Homo sapiens), 12567 (Mus musculus) 481131 (Canis lupus familiaris), 510618 (Bos taurus), 715650 (Macaca mulatta), 94201 (Rattus norvegicus) |
| Gene Symbols & Synonyms | CDK4,Cdk4,CMM3,PSK-J3,Crk3 |
| Target Alternative Names | CDK4,CMM3,Cdk4,Cell division protein kinase 4,Crk3,Cyclin-dependent kinase 4,PSK-J3 |
| Uniprot Accession |
P11802,P30285,P35426,Q32KY4
Additional SwissProt Accessions: P11802,P30285,Q32KY4,P35426 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer, Non-Small Cell Lung Cancer |
| Disease from KEGG | Endocrine resistance, p53 signaling pathway, PI3K-Akt signaling pathway, Cellular senescence, Tight junction, T cell receptor signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Cushing syndrome, Hepatitis C, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Pancreatic cancer, Glioma, Melanoma, Bladder cancer, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma |
| Gene Ensembl | ENSECAG00000025015, ENSG00000135446, ENSMUSG00000006728, ENSCAFG00845013840, ENSBTAG00000007160, ENSMMUG00000023694 |
| Target Classification | Kinase |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


