Human AURKC/AIE2/AIK3 ORF/cDNA clone-Lentivirus particle (NM_001015878.1)

Cat. No.: vGMLP005195

Pre-made Human AURKC/AIE2/AIK3 Lentiviral expression plasmid for AURKC lentivirus packaging, AURKC lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to AURKC/AIE2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005195 Human AURKC Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005195
Gene Name AURKC
Accession Number NM_001015878.1
Gene ID 6795
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 930 bp
Gene Alias AIE2,AIK3,ARK3,AurC,aurora-C,HEL-S-90,SPGF5,STK13
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCTCCCCCAGAGCTGTGGTGCAGCTGGGCAAAGCTCAACCTGCAGGCGAAGAGTTGGCTACAGCAAACCAAACAGCCCAGCAGCCCAGCAGCCCAGCCATGCGGCGCCTCACAGTCGATGACTTTGAAATCGGGCGTCCCCTGGGCAAGGGGAAATTTGGGAATGTGTACCTGGCTCGGCTCAAGGAAAGCCATTTCATTGTGGCCCTGAAGGTTCTCTTCAAGTCGCAGATAGAGAAGGAAGGACTGGAGCACCAGCTGCGCCGGGAAATTGAGATCCAGGCTCATCTACAACACCCCAATATCCTGCGCCTGTATAACTATTTCCATGATGCACGCCGGGTGTACCTGATTCTGGAATATGCTCCAAGGGGTGAGCTCTACAAGGAGCTGCAGAAAAGCGAGAAATTAGATGAACAGCGCACAGCCACGATAATAGAGGAGTTGGCAGATGCCCTGACCTACTGCCATGACAAGAAAGTGATTCACAGAGATATTAAGCCAGAGAACCTGCTGCTGGGGTTCAGGGGTGAGGTGAAGATTGCAGATTTTGGCTGGTCTGTGCACACCCCCTCCCTGAGGAGGAAGACAATGTGTGGGACACTGGACTACTTGCCGCCAGAAATGATTGAGGGGAGAACATATGATGAAAAGGTGGATTTGTGGTGCATTGGAGTGCTCTGCTATGAGCTGCTGGTGGGATATCCACCCTTTGAGAGCGCCTCCCACAGTGAGACTTACAGACGCATCCTCAAGGTAGATGTGAGGTTTCCACTATCAATGCCTCTGGGGGCCCGGGACTTGATTTCCAGGCTTCTCAGATACCAGCCCTTGGAGAGACTGCCCCTGGCCCAGATCCTGAAGCACCCCTGGGTTCAGGCCCACTCCCGAAGGGTGCTGCCTCCCTGTGCTCAGATGGCTTCCTGA
ORF Protein Sequence MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T97592-Ab Anti-AURKC monoclonal antibody
    Target Antigen GM-Tg-g-T97592-Ag AURKC protein
    ORF Viral Vector pGMLP000985 Human AURKC Lentivirus plasmid
    ORF Viral Vector pGMLP005195 Human AURKC Lentivirus plasmid
    ORF Viral Vector vGMLP000985 Human AURKC Lentivirus particle
    ORF Viral Vector vGMLP005195 Human AURKC Lentivirus particle


    Target information

    Target ID GM-T97592
    Target Name AURKC
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6795
    Gene ID 100051177 (Equus caballus), 102899963 (Felis catus), 119870878 (Canis lupus familiaris), 20871 (Mus musculus)
    292554 (Rattus norvegicus), 618599 (Bos taurus), 6795 (Homo sapiens), 709801 (Macaca mulatta)
    Gene Symbols & Synonyms AURKC,Aurkc,STK13,AIE1,AIK3,IAK3,ARK-3,Stk13,AIE2,ARK3,AurC,SPGF5,HEL-S-90,aurora-C
    Target Alternative Names AIE1,AIE2,AIK3,ARK-3,ARK3,AURKC,AurC,Aurkc,Aurora 3,Aurora kinase C,Aurora-related kinase 3),Aurora/IPL1-related kinase 3 (ARK-3,Aurora/IPL1/Eg2 protein 2,HEL-S-90,IAK3,SPGF5,STK13,Serine/threonine-protein kinase 13,Serine/threonine-protein kinase aurora-C,Stk13,aurora-C
    Uniprot Accession O88445,Q9UQB9
    Additional SwissProt Accessions: O88445,Q9UQB9
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000021736, ENSCAFG00845001500, ENSMUSG00000070837, ENSG00000105146
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.