Human JPH2/CMH17/JP-2 ORF/cDNA clone-Lentivirus particle (NM_175913)

Cat. No.: vGMLP005076

Pre-made Human JPH2/CMH17/JP-2 Lentiviral expression plasmid for JPH2 lentivirus packaging, JPH2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to JPH2/CMH17 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005076 Human JPH2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005076
Gene Name JPH2
Accession Number NM_175913
Gene ID 57158
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 390 bp
Gene Alias CMH17,JP-2,JP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTGGGGGCCGCTTCGACTTTGATGATGGAGGGGCGTACTGCGGGGGCTGGGAGGGGGGAAAGGCCCATGGGCATGGACTGTGCACAGGCCCCAAGGGCCAGGGCGAATACTCTGGCTCCTGGAACTTTGGCTTTGAGGTGGCAGGTGTCTACACCTGGCCCAGCGGAAACACCTTTGAGGGATACTGGAGCCAGGGCAAACGGCATGGGCTGGGCATAGAGACCAAGGGGCGCTGGCTCTACAAGGGCGAGTGGACACATGGCTTCAAGGGACGCTACGGAATCCGGCAGAGCTCAAGCAGCGGTGCCAAGTATGAGGGCACCTGGAACAATGGCCTGCAAGACGGCTATGGCACCGAGACCTATGCTGATGGAGGGATGTGTTAA
ORF Protein Sequence MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGTETYADGGMC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0652-Ab Anti-JPH2/ CMH17/ JP-2 monoclonal antibody
    Target Antigen GM-Tg-g-MP0652-Ag JPH2 VLP (virus-like particle)
    ORF Viral Vector pGMLP005076 Human JPH2 Lentivirus plasmid
    ORF Viral Vector pGMLV000973 Human JPH2 Lentivirus plasmid
    ORF Viral Vector vGMLP005076 Human JPH2 Lentivirus particle
    ORF Viral Vector vGMLV000973 Human JPH2 Lentivirus particle


    Target information

    Target ID GM-MP0652
    Target Name JPH2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    57158
    Gene ID 102899147 (Felis catus), 106782408 (Equus caballus), 296345 (Rattus norvegicus), 57158 (Homo sapiens)
    59091 (Mus musculus), 610874 (Canis lupus familiaris), 614651 (Bos taurus), 694158 (Macaca mulatta)
    Gene Symbols & Synonyms JPH2,Jph2,JP2,JP-2,CMD2E,CMH17,Jp2,1110002E14Rik
    Target Alternative Names JPH2,Junctophilin-2,JP-2,Junctophilin type 2,JP2,JP-2,CMD2E,CMH17
    Uniprot Accession Q2PS20,Q9BR39,Q9ET78
    Additional SwissProt Accessions: Q2PS20,Q9BR39,Q9ET78
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000016786, ENSG00000149596, ENSMUSG00000017817, ENSCAFG00845013468, ENSBTAG00000068398, ENSMMUG00000022865
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.