Human RLN3/H3/insl7 ORF/cDNA clone-Lentivirus particle (NM_080864)

Cat. No.: vGMLP005057

Pre-made Human RLN3/H3/insl7 Lentiviral expression plasmid for RLN3 lentivirus packaging, RLN3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RLN3/H3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005057 Human RLN3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005057
Gene Name RLN3
Accession Number NM_080864
Gene ID 117579
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 429 bp
Gene Alias H3,insl7,RXN3,ZINS4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAGGTACATGCTGCTGCTGCTCCTGGCGGTATGGGTGCTGACCGGGGAGCTGTGGCCGGGAGCTGAGGCCCGGGCAGCGCCTTACGGGGTCAGGCTTTGCGGCCGAGAATTCATCCGAGCAGTCATCTTCACCTGCGGGGGCTCCCGGTGGAGACGATCAGACATCCTGGCCCACGAGGCTATGGGAGATACCTTCCCGGATGCAGATGCTGATGAAGACAGTCTGGCAGGCGAGCTGGATGAGGCCATGGGGTCCAGCGAGTGGCTGGCCCTGACCAAGTCACCCCAGGCCTTTTACAGGGGGCGACCCAGCTGGCAAGGAACCCCTGGGGTTCTTCGGGGCAGCCGAGATGTCCTGGCTGGCCTTTCCAGCAGCTGCTGCAAGTGGGGGTGTAGCAAAAGTGAAATCAGTAGCCTTTGCTAG
ORF Protein Sequence MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1243-Ab Anti-REL3/ RLN3/ H3 functional antibody
    Target Antigen GM-Tg-g-SE1243-Ag RLN3 protein
    ORF Viral Vector pGMLP005057 Human RLN3 Lentivirus plasmid
    ORF Viral Vector vGMLP005057 Human RLN3 Lentivirus particle


    Target information

    Target ID GM-SE1243
    Target Name RLN3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    117579
    Gene ID 100300034 (Bos taurus), 100630151 (Equus caballus), 101090240 (Felis catus), 117579 (Homo sapiens)
    119864730 (Canis lupus familiaris), 212108 (Mus musculus), 266997 (Rattus norvegicus), 717577 (Macaca mulatta)
    Gene Symbols & Synonyms RLN3,Rln3,H3,RXN3,ZINS4,insl7,M3,Insl7,RLX3
    Target Alternative Names RLN3,Relaxin-3,Insulin-like peptide INSL7 (Insulin-like peptide 7), Prorelaxin H3,H3,RXN3,ZINS4,insl7
    Uniprot Accession Q8BFS3,Q8CHK2,Q8WXF3
    Additional SwissProt Accessions: Q8WXF3,Q8CHK2,Q8BFS3
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction, Relaxin signaling pathway
    Gene Ensembl ENSBTAG00000055930, ENSG00000171136, ENSCAFG00845025377, ENSMUSG00000045232, ENSMMUG00000060189
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.