Human PDPN/AGGRUS/GP36 ORF/cDNA clone-Lentivirus particle (NM_006474)

Cat. No.: vGMLP004978

Pre-made Human PDPN/AGGRUS/GP36 Lentiviral expression plasmid for PDPN lentivirus packaging, PDPN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PDPN/Podoplanin/PDPN/AGGRUS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004978 Human PDPN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004978
Gene Name PDPN
Accession Number NM_006474
Gene ID 10630
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 717 bp
Gene Alias AGGRUS,GP36,Gp38,GP40,HT1A-1,OTS8,PA2.26,T1A,T1A-2,T1A2,TI1A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGAAGGTGTCAGCTCTGCTCTTCGTTTTGGGAAGCGCGTCGCTCTGGGTCCTGGCAGAAGGAGCCAGCACAGGCCAGCCAGAAGATGACACTGAGACTACAGGTTTGGAAGGCGGCGTTGCCATGCCAGGTGCCGAAGATGATGTGGTGACTCCAGGAACCAGCGAAGACCGCTATAAGTCTGGCTTGACAACTCTGGTGGCAACAAGTGTCAACAGTGTAACAGGCATTCGCATCGAGGATCTGCCAACTTCAGAAAGCACAGTCCACGCGCAAGAACAAAGTCCAAGCGCCACAGCCTCAAACGTGGCCACCAGTCACTCCACGGAGAAAGTGGATGGAGACACACAGACAACAGTTGAGAAAGATGGTTTGTCAACAGTGACCCTGGTTGGAATCATAGTTGGGGTCTTACTAGCCATCGGCTTCATTGGTGCAATCATCGTTGTGGTTATGCGAAAAATGTCGGGAAGGTACTCGCCCTAA
ORF Protein Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1359-Ab Anti-PDPN/ AGGRUS/ GP36 monoclonal antibody
    Target Antigen GM-Tg-g-MP1359-Ag PDPN VLP (virus-like particle)
    ORF Viral Vector pGMLP004978 Human PDPN Lentivirus plasmid
    ORF Viral Vector vGMLP004978 Human PDPN Lentivirus particle


    Target information

    Target ID GM-MP1359
    Target Name PDPN/Podoplanin
    Gene Group Identifier
    (Target Gene ID in Homo species)
    10630
    Gene ID 101081910 (Felis catus), 102148273 (Equus caballus), 10630 (Homo sapiens), 14726 (Mus musculus)
    403886 (Canis lupus familiaris), 509732 (Bos taurus), 54320 (Rattus norvegicus), 716250 (Macaca mulatta)
    Gene Symbols & Synonyms PDPN,Pdpn,T1A,GP36,GP40,Gp38,OTS8,T1A2,TI1A,D2-40,T1A-2,AGGRUS,HT1A-1,PA2.26,E11,T1a,OTS-8,T1alpha,RANDAM-2,T1-alpha,RTI40,RTI140
    Target Alternative Names AGGRUS,Aggrus,D2-40,E11,GP36,GP40,Glycoprotein 36 (Gp36),Gp38,HT1A-1,OTS-8,OTS8,PA2.26,PA2.26 antigen,PDPN,Pdpn,Podoplanin,RANDAM-2,RTI140,RTI40,T1-alpha,T1-alpha (T1A),T1A,T1A-2,T1A2,T1a,T1alpha,TI1A
    Uniprot Accession Q62011,Q64294,Q86YL7,Q95152
    Additional SwissProt Accessions: Q86YL7,Q62011,Q95152,Q64294
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000032595, ENSG00000162493, ENSMUSG00000028583, ENSCAFG00845001081, ENSBTAG00000001788, ENSMMUG00000000145
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.