Human IAPP/DAP/IAP ORF/cDNA clone-Lentivirus particle (NM_000415)

Cat. No.: vGMLP004968

Pre-made Human IAPP/DAP/IAP Lentiviral expression plasmid for IAPP lentivirus packaging, IAPP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Amylin/IAPP/IAPP/DAP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004968 Human IAPP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004968
Gene Name IAPP
Accession Number NM_000415
Gene ID 3375
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 270 bp
Gene Alias DAP,IAP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCATCCTGAAGCTGCAAGTATTTCTCATTGTGCTCTCTGTTGCATTGAACCATCTGAAAGCTACACCCATTGAAAGTCATCAGGTGGAAAAGCGGAAATGCAACACTGCCACATGTGCAACGCAGCGCCTGGCAAATTTTTTAGTTCATTCCAGCAACAACTTTGGTGCCATTCTCTCATCTACCAACGTGGGATCCAATACATATGGCAAGAGGAATGCAGTAGAGGTTTTAAAGAGAGAGCCACTGAATTACTTGCCCCTTTAG
ORF Protein Sequence MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T56269-Ab Anti-IAPP/ DAP/ IAP functional antibody
    Target Antigen GM-Tg-g-T56269-Ag IAPP protein
    ORF Viral Vector pGMLP004968 Human IAPP Lentivirus plasmid
    ORF Viral Vector vGMLP004968 Human IAPP Lentivirus particle


    Target information

    Target ID GM-T56269
    Target Name Amylin/IAPP
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3375
    Gene ID 100138011 (Bos taurus), 100629466 (Equus caballus), 114670806 (Macaca mulatta), 15874 (Mus musculus)
    24476 (Rattus norvegicus), 3375 (Homo sapiens), 403909 (Canis lupus familiaris), 751513 (Felis catus)
    Gene Symbols & Synonyms IAPP,Iapp,Amylin,DAP,IAP
    Target Alternative Names Amylin,DAP,Diabetes-associated peptide (DAP),IAP,IAPP,Iapp,Insulinoma amyloid peptide,Islet amyloid polypeptide
    Uniprot Accession P10997,P12967,P12968,P12969,P17716,Q28207
    Additional SwissProt Accessions: Q28207,P12968,P12969,P10997,P17716,P12967
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSBTAG00000010530, ENSMMUG00000032087, ENSMUSG00000041681, ENSG00000121351, ENSCAFG00845015514
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.