Human GALP ORF/cDNA clone-Lentivirus particle (NM_033106)

Cat. No.: vGMLP004967

Pre-made Human GALP/ Lentiviral expression plasmid for GALP lentivirus packaging, GALP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GALP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004967 Human GALP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004967
Gene Name GALP
Accession Number NM_033106
Gene ID 85569
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 351 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCTCCCTCCGTCCCCCTGGTCCTCCTCCTCGTCCTCTTGCTGAGCCTGGCAGAGACTCCAGCATCCGCACCTGCCCACCGGGGACGAGGAGGCTGGACCCTCAATAGTGCTGGCTACCTTCTGGGTCCCGTCCTCCACCTTCCCCAAATGGGTGACCAAGACGGAAAGAGGGAGACAGCCCTTGAGATCCTAGACCTGTGGAAGGCCATCGACGGGCTCCCCTACTCCCACCCTCCACAGCCCTCCAAGAGGAATGTGATGGAGACGTTTGCCAAACCAGAGATTGGAGATCTGGGCATGCTCAGCATGAAAATTCCCAAGGAGGAAGATGTCCTGAAGTCATAG
ORF Protein Sequence MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0934-Ab Anti-GALP functional antibody
    Target Antigen GM-Tg-g-SE0934-Ag GALP protein
    ORF Viral Vector pGMLP004967 Human GALP Lentivirus plasmid
    ORF Viral Vector vGMLP004967 Human GALP Lentivirus particle


    Target information

    Target ID GM-SE0934
    Target Name GALP
    Gene Group Identifier
    （Target Gene ID in Homo species)         		85569
    Gene ID 102150242 (Equus caballus), 102151546 (Canis lupus familiaris), 109494653 (Felis catus), 232836 (Mus musculus)
    64568 (Rattus norvegicus), 704323 (Macaca mulatta), 85569 (Homo sapiens)
    Gene Symbols & Synonyms GALP,Galp,GAL
    Target Alternative Names GAL,GALP,Galanin-like peptide,Galp
    Uniprot Accession Q810H5,Q9QXQ6,Q9UBC7
    Additional SwissProt Accessions: Q810H5,Q9QXQ6,Q9UBC7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSCAFG00845000284, ENSMUSG00000034660, ENSG00000197487
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.