Human DEFB126/bA530N10.1/C20orf8 ORF/cDNA clone-Lentivirus particle (NM_030931)

Cat. No.: vGMLP004966

Pre-made Human DEFB126/bA530N10.1/C20orf8 Lentiviral expression plasmid for DEFB126 lentivirus packaging, DEFB126 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to DEFB126/bA530N10.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004966 Human DEFB126 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004966
Gene Name DEFB126
Accession Number NM_030931
Gene ID 81623
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 336 bp
Gene Alias bA530N10.1,C20orf8,DEFB-26,DEFB26,hBD-26,HBD26
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTCCCTACTGTTCACCCTTGCAGTTTTTATGCTCCTGGCCCAATTGGTCTCAGGTAATTGGTATGTGAAAAAGTGTCTAAACGACGTTGGAATTTGCAAGAAGAAGTGCAAACCTGAAGAGATGCATGTAAAGAATGGTTGGGCAATGTGCGGCAAACAAAGGGACTGCTGTGTTCCAGCTGACAGACGTGCTAATTATCCTGTTTTCTGTGTCCAGACAAAGACTACAAGAATTTCAACAGTAACAGCAACAACAGCAACAACAACTTTGATGATGACTACTGCTTCGATGTCTTCGATGGCTCCTACCCCCGTTTCTCCCACTGGTTGA
ORF Protein Sequence MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0152-Ab Anti-DB126/ DEFB126/ C20orf8 functional antibody
    Target Antigen GM-Tg-g-SE0152-Ag DEFB126 protein
    ORF Viral Vector pGMLP004966 Human DEFB126 Lentivirus plasmid
    ORF Viral Vector vGMLP004966 Human DEFB126 Lentivirus particle


    Target information

    Target ID GM-SE0152
    Target Name DEFB126
    Gene Group Identifier
    (Target Gene ID in Homo species)
    81623
    Gene ID 100683529 (Canis lupus familiaris), 102147536 (Equus caballus), 171412 (Rattus norvegicus), 442835 (Mus musculus)
    714089 (Macaca mulatta), 81623 (Homo sapiens)
    Gene Symbols & Synonyms DEFB126,Defb22,CBD141,2D6glycoprotein,9230002F21Rik,HBD26,DEFB26,hBD-26,C20orf8,DEFB-26,bA530N10.1
    Target Alternative Names 2D6glycoprotein,9230002F21Rik,Beta-defensin 126,Beta-defensin 26 (DEFB-26),C20orf8,CBD141,DEFB-26,DEFB126,DEFB26,Defb22,Defensin,Epididymal secretory protein 13.2 (ESP13.2),HBD26,bA530N10.1,beta 126,hBD-26
    Uniprot Accession Q8BVC1,Q9BYW3
    Additional SwissProt Accessions: Q8BVC1,Q9BYW3
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSCAFG00845017576, ENSECAG00000011927, ENSMUSG00000027468, ENSG00000125788
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.