Human ADM2/AM2/dJ579N16.4 ORF/cDNA clone-Lentivirus particle (NM_001253845)
Cat. No.: vGMLP004965
Pre-made Human ADM2/AM2/dJ579N16.4 Lentiviral expression plasmid for ADM2 lentivirus packaging, ADM2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
ADM2/AM2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004965 | Human ADM2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004965 |
| Gene Name | ADM2 |
| Accession Number | NM_001253845 |
| Gene ID | 79924 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 447 bp |
| Gene Alias | AM2,dJ579N16.4 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCGGATCCCGACGGCCGCCCTGGGTTGCATCAGCCTCCTCTGCCTGCAGCTCCCTGGCTCGCTGTCCCGCAGCCTGGGCGGGGACCCGCGACCCGTCAAACCCAGGGAGCCCCCAGCCCGGAGCCCTTCCAGCAGCCTGCAGCCCAGGCACCCCGCACCCCGACCTGTGGTCTGGAAGCTTCACCGGGCCCTCCAGGCACAGAGGGGTGCCGGCCTGGCCCCTGTTATGGGTCAGCCTCTCCGGGATGGTGGCCGCCAACACTCGGGCCCCCGAAGACACTCGGGCCCCCGCAGGACCCAAGCCCAGCTCCTGCGAGTGGGCTGTGTGCTGGGCACCTGCCAGGTGCAGAATCTCAGCCACCGCCTGTGGCAACTCATGGGACCGGCCGGCCGGCAGGACTCAGCTCCTGTGGACCCCAGCAGCCCCCACAGCTATGGCTGA |
| ORF Protein Sequence | MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T68208-Ab | Anti-ADM2/ AM2/ dJ579N16.4 functional antibody |
| Target Antigen | GM-Tg-g-T68208-Ag | ADM2 protein |
| ORF Viral Vector | pGMLP004965 | Human ADM2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004965 | Human ADM2 Lentivirus particle |
Target information
| Target ID | GM-T68208 |
| Target Name | ADM2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
79924 |
| Gene ID |
100629546 (Equus caballus), 101084977 (Felis catus), 223780 (Mus musculus), 399475 (Rattus norvegicus) 606919 (Canis lupus familiaris), 618896 (Bos taurus), 720666 (Macaca mulatta), 79924 (Homo sapiens) |
| Gene Symbols & Synonyms | ADM2,Adm2,Am2,IMD,Imdn,Imd,AM2,dJ579N16.4 |
| Target Alternative Names | ADM2,AM2,Adm2,Am2,IMD,Imd,Imdn,Intermedin,Protein ADM2,dJ579N16.4 |
| Uniprot Accession |
P61312,Q7TNK8,Q7Z4H4
Additional SwissProt Accessions: Q7TNK8,P61312,Q7Z4H4 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction |
| Gene Ensembl | ENSMUSG00000054136, ENSCAFG00845028178, ENSMMUG00000062822, ENSG00000128165 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


