Human Rgcc/bA157L14.2/C13orf15 ORF/cDNA clone-Lentivirus particle (NM_014059)

Cat. No.: vGMLP004954

Pre-made Human Rgcc/bA157L14.2/C13orf15 Lentiviral expression plasmid for Rgcc lentivirus packaging, Rgcc lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RGC32/RGCC/Rgcc/bA157L14.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004954 Human Rgcc Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004954
Gene Name Rgcc
Accession Number NM_014059
Gene ID 28984
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 414 bp
Gene Alias bA157L14.2,C13orf15,RGC-32,RGC32
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCCGCCCGCGGCGCAGGGCAGCCCCGCGGCCGCCGCGGCCGCAGCCCCGGCCCTGGACTCGGCGGCCGCGGAGGACCTGTCGGACGCGCTGTGCGAGTTTGACGCGGTGCTGGCCGACTTCGCGTCGCCCTTCCACGAGCGCCACTTCCACTACGAGGAGCACCTGGAGCGCATGAAGCGGCGCAGCAGCGCCAGTGTCAGCGACAGCAGCGGCTTCAGCGACTCGGAGAGTGCAGATTCACTTTATAGGAACAGCTTCAGCTTCAGTGATGAAAAACTGAATTCTCCAACAGACTCTACCCCAGCTCTTCTCTCTGCCACTGTCACTCCTCAGAAAGCTAAATTAGGAGACACAAAAGAGCTAGAAGCCTTCATTGCTGATCTTGACAAAACTTTAGCAAGTATGTGA
ORF Protein Sequence MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1444-Ab Anti-RGCC/ C13orf15/ RGC-32 functional antibody
    Target Antigen GM-Tg-g-SE1444-Ag RGCC protein
    ORF Viral Vector pGMLP004954 Human Rgcc Lentivirus plasmid
    ORF Viral Vector vGMLP004954 Human Rgcc Lentivirus particle


    Target information

    Target ID GM-SE1444
    Target Name RGC32/RGCC
    Gene Group Identifier
    （Target Gene ID in Homo species)         		28984
    Gene ID 100061031 (Equus caballus), 101090320 (Felis catus), 117183 (Rattus norvegicus), 28984 (Homo sapiens)
    609534 (Canis lupus familiaris), 614348 (Bos taurus), 66214 (Mus musculus), 698962 (Macaca mulatta)
    Gene Symbols & Synonyms RGCC,Rgcc,Rgc32,RGC32,RGC-32,C13orf15,bA157L14.2,C22H13orf15,C12H13orf15,Rgc-32,1190002H23Rik,C17H13orf15
    Target Alternative Names RGC32, RGCC,Regulator of cell cycle RGCC,Response gene to complement 32 protein (RGC-32),RGC32,RGC-32,C13orf15,bA157L14.2
    Uniprot Accession Q9DBX1,Q9H4X1,Q9Z2P4
    Additional SwissProt Accessions: Q9Z2P4,Q9H4X1,Q9DBX1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000102760, ENSCAFG00845012012, ENSMUSG00000022018, ENSMMUG00000011593
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.