Human SLC25A1/CTP/D2L2AD ORF/cDNA clone-Lentivirus particle (NM_001256534)

Cat. No.: vGMLP004898

Pre-made Human SLC25A1/CTP/D2L2AD Lentiviral expression plasmid for SLC25A1 lentivirus packaging, SLC25A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SLC25A1/CTP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004898 Human SLC25A1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004898
Gene Name SLC25A1
Accession Number NM_001256534
Gene ID 6576
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 957 bp
Gene Alias CTP,D2L2AD,SEA,SLC20A3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCCCCGCGGCACTGGCGCGGCGGCCGCGCCGACCGAAGTCCGGGACGGGGGAGGGGCCCGAGCGCCAGCGGCCGGGCGGGAGTCTCAGGAGCGGGTTCCCGGTCCCTGCAGGCGGCCTGGCGGGTGGCATCGAGATCTGCATCACCTTCCCCACCGAGTACGTGAAGACGCAGCTGCAGCTGGACGAGCGCTCGCACCCGCCGCGGTACCGGGGCATCGGGGACTGCGTGCGGCAGACGGTTCGCAGCCATGGCGTCCTGGGCCTGTACCGCGGCCTTAGCTCCCTGCTCTACGGTTCCATCCCCAAGGCGGCCGTCAGGTTTGGAATGTTCGAGTTCCTCAGCAACCACATGCGGGATGCCCAGGGACGGCTGGACAGCACGCGTGGGCTGCTGTGCGGCCTGGGCGCTGGCGTGGCCGAGGCCGTGGTGGTCGTGTGCCCCATGGAGACCATCAAGGTGAAGTTCATCCACGACCAGACCTCCCCAAACCCCAAGTACAGAGGATTCTTCCACGGGGTTAGGGAGATTGTGCGGGAACAAGGGCTGAAGGGGACGTACCAGGGCCTCACAGCCACTGTCCTGAAGCAGGGCTCGAACCAGGCCATCCGCTTCTTCGTCATGACCTCCCTGCGCAACTGGTACCGAGGGGACAACCCCAACAAGCCCATGAACCCTCTGATCACTGGGGTCTTCGGAGCTATTGCAGGCGCAGCCAGTGTCTTTGGAAACACTCCTCTGGATGTGATTAAGACCCGGATGCAGGGCCTGGAGGCGCACAAATACCGGAACACGTGGGACTGCGGCTTGCAGATCCTGAAGAAGGAGGGGCTCAAGGCATTCTACAAGGGCACTGTCCCCCGCCTGGGCCGGGTCTGCCTGGATGTGGCCATAGTGTTTGTCATCTATGATGAAGTGGTGAAGCTGCTCAACAAAGTGTGGAAGACGGACTAA
ORF Protein Sequence MFPAALARRPRRPKSGTGEGPERQRPGGSLRSGFPVPAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T06064-Ab Anti-SLC25A1 monoclonal antibody
    Target Antigen GM-Tg-g-T06064-Ag SLC25A1 protein
    ORF Viral Vector pGMLP004898 Human SLC25A1 Lentivirus plasmid
    ORF Viral Vector vGMLP004898 Human SLC25A1 Lentivirus particle


    Target information

    Target ID GM-T06064
    Target Name SLC25A1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6576
    Gene ID 100053137 (Equus caballus), 101081502 (Felis catus), 13358 (Mus musculus), 282476 (Bos taurus)
    29743 (Rattus norvegicus), 608348 (Canis lupus familiaris), 6576 (Homo sapiens), 719075 (Macaca mulatta)
    Gene Symbols & Synonyms SLC25A1,Slc25a1,Ctp,Dgsj,Slc20a3,1300019P08Rik,2610100G11Rik,Cic,CIC,CTP,SEA,CMS23,D2L2AD,SLC20A3
    Target Alternative Names 1300019P08Rik,2610100G11Rik,CIC,CMS23,CTP,Cic,Citrate transport protein (CTP),Ctp,D2L2AD,Dgsj,Mitochondrial citrate carrier (CIC),SEA,SLC20A3,SLC25A1,Slc20a3,Slc25a1,Solute carrier family 25 member 1,Tricarboxylate carrier protein,Tricarboxylate transport protein,mitochondrial
    Uniprot Accession P32089,P53007,P79110,Q8JZU2
    Additional SwissProt Accessions: Q8JZU2,P79110,P32089,P53007
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000003528, ENSBTAG00000008528, ENSCAFG00845030106, ENSG00000100075
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.