Human MYL4/ALC1/AMLC ORF/cDNA clone-Lentivirus particle (NM_002476)

Cat. No.: vGMLP004880

Pre-made Human MYL4/ALC1/AMLC Lentiviral expression plasmid for MYL4 lentivirus packaging, MYL4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to MYL4/ALC1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004880 Human MYL4 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004880
Gene Name MYL4
Accession Number NM_002476
Gene ID 4635
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 594 bp
Gene Alias ALC1,AMLC,GT1,PRO1957
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCCAAGAAGCCTGAGCCTAAGAAGGAGGCAGCCAAGCCAGCTCCAGCTCCAGCTCCAGCCCCTGCACCAGCCCCTGCCCCAGCTCCTGAGGCTCCCAAGGAACCTGCCTTTGACCCCAAGAGTGTAAAGATAGACTTCACTGCCGACCAGATTGAAGAGTTCAAAGAGGCCTTTTCATTGTTTGACCGGACCCCGACTGGAGAGATGAAGATCACCTACGGCCAGTGCGGGGATGTACTGCGGGCCCTGGGCCAGAACCCTACCAATGCCGAGGTGCTGCGTGTGCTGGGCAAGCCCAAGCCTGAAGAGATGAATGTCAAGATGCTGGACTTTGAGACGTTCTTGCCCATCCTGCAGCACATTTCCCGCAACAAGGAGCAGGGCACCTATGAGGACTTCGTGGAGGGCCTGCGTGTCTTTGACAAGGAGAGCAATGGCACGGTCATGGGTGCTGAGCTTCGGCACGTCCTTGCCACCCTGGGAGAGAAGATGACTGAGGCTGAAGTGGAGCAGCTGTTAGCTGGGCAAGAGGATGCCAATGGCTGCATCAATTATGAAGCCTTTGTCAAGCACATCATGTCAGGGTGA
ORF Protein Sequence MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2615-Ab Anti-MYL4 monoclonal antibody
    Target Antigen GM-Tg-g-IP2615-Ag MYL4 protein
    ORF Viral Vector pGMLP004880 Human MYL4 Lentivirus plasmid
    ORF Viral Vector vGMLP004880 Human MYL4 Lentivirus particle


    Target information

    Target ID GM-IP2615
    Target Name MYL4
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4635
    Gene ID 100054510 (Equus caballus), 100316866 (Felis catus), 17896 (Mus musculus), 4635 (Homo sapiens)
    480490 (Canis lupus familiaris), 504201 (Bos taurus), 688228 (Rattus norvegicus), 717354 (Macaca mulatta)
    Gene Symbols & Synonyms MYL4,Myl4,ELC,GT1,ALC1,AMLC,Myla,ELC1a,MLC1a,MLC1EMB,PRO1957,MLC1E/A
    Target Alternative Names ALC1,AMLC,ELC,ELC1a,GT1,MLC1E/A,MLC1EMB,MLC1a,MYL4,Myl4,Myla,Myosin light chain 1,Myosin light chain 4,Myosin light chain alkali GT-1 isoform,PRO1957,embryonic muscle/atrial isoform
    Uniprot Accession P09541,P12829,P17209
    Additional SwissProt Accessions: P09541,P12829,P17209
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG Adrenergic signaling in cardiomyocytes
    Gene Ensembl ENSECAG00000020967, ENSMUSG00000061086, ENSG00000198336, ENSBTAG00000021916, ENSMMUG00000018600
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.