Human NMB ORF/cDNA clone-Lentivirus particle (NM_205858)

Cat. No.: vGMLP004854

Pre-made Human NMB/ Lentiviral expression plasmid for NMB lentivirus packaging, NMB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to Neuromedin B/neuromedin B/NMB/NMB products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004854 Human NMB Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004854
Gene Name NMB
Accession Number NM_205858
Gene ID 4828
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 465 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCGGCGGGCGGGGGGCGCTCGGATGTTCGGCAGCCTCCTGCTCTTCGCCCTGCTCGCTGCCGGCGTCGCCCCGCTCAGCTGGGATCTCCCGGAGCCCCGCAGCCGAGCCAGCAAGATCCGAGTGCACTCGCGAGGCAACCTCTGGGCCACCGGTCACTTCATGGGCAAGAAGAGTCTGGAGCCTTCCAGCCCATCCCCATTGGGGACAGCTCCCCACACCTCCCTGAGGGACCAGCGACTGCAGCTGAGTCATGATCTGCTCGGAATCCTCCTGCTAAAGAAGGCTCTGGGCGTGAGCCTCAGCCGCCCCGCACCCCAAATCCAGGAGGCTGCTGGTACAAATACTGCAGAAATGACACCAATAATGGGGCAGACACAACAGCGTGGCTTAGATTGTGCCCACCCAGGGAAGGTGCTGAATGGGACCCTGTTGATGGCCCCATCTGGATGTAAATCCTGA
ORF Protein Sequence MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQEAAGTNTAEMTPIMGQTQQRGLDCAHPGKVLNGTLLMAPSGCKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0370-Ab Anti-NMB functional antibody
    Target Antigen GM-Tg-g-SE0370-Ag NMB protein
    ORF Viral Vector pGMLP004854 Human NMB Lentivirus plasmid
    ORF Viral Vector vGMLP004854 Human NMB Lentivirus particle


    Target information

    Target ID GM-SE0370
    Target Name Neuromedin B/neuromedin B/NMB
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4828
    Gene ID 100053292 (Equus caballus), 101086813 (Felis catus), 106999270 (Macaca mulatta), 479051 (Canis lupus familiaris)
    4828 (Homo sapiens), 499194 (Rattus norvegicus), 506584 (Bos taurus), 68039 (Mus musculus)
    Gene Symbols & Synonyms NMB,Nmb,RGD1562710,3110023K12Rik
    Target Alternative Names 3110023K12Rik,NMB,Neuromedin B,Neuromedin-B,Nmb,RGD1562710,neuromedin B
    Uniprot Accession P08949,Q2T9U8,Q9CR53
    Additional SwissProt Accessions: P08949,Q2T9U8,Q9CR53
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000008013, ENSMMUG00000045634, ENSCAFG00845002835, ENSG00000197696, ENSBTAG00000058029, ENSMUSG00000025723
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.