Human IL36RN/FIL1/FIL1(DELTA) ORF/cDNA clone-Lentivirus particle (NM_173170)
Cat. No.: vGMLP004790
Pre-made Human IL36RN/FIL1/FIL1(DELTA) Lentiviral expression plasmid for IL36RN lentivirus packaging, IL36RN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IL-36RN/IL36RN/IL36RN/FIL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004790 | Human IL36RN Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004790 |
| Gene Name | IL36RN |
| Accession Number | NM_173170 |
| Gene ID | 26525 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 468 bp |
| Gene Alias | FIL1,FIL1(DELTA),FIL1D,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP,PSORS14 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGTCCTGAGTGGGGCGCTGTGCTTCCGAATGAAGGACTCGGCATTGAAGGTGCTTTATCTGCATAATAACCAGCTTCTAGCTGGAGGGCTGCATGCAGGGAAGGTCATTAAAGGTGAAGAGATCAGCGTGGTCCCCAATCGGTGGCTGGATGCCAGCCTGTCCCCCGTCATCCTGGGTGTCCAGGGTGGAAGCCAGTGCCTGTCATGTGGGGTGGGGCAGGAGCCGACTCTAACACTAGAGCCAGTGAACATCATGGAGCTCTATCTTGGTGCCAAGGAATCCAAGAGCTTCACCTTCTACCGGCGGGACATGGGGCTCACCTCCAGCTTCGAGTCGGCTGCCTACCCGGGCTGGTTCCTGTGCACGGTGCCTGAAGCCGATCAGCCTGTCAGACTCACCCAGCTTCCCGAGAATGGTGGCTGGAATGCCCCCATCACAGACTTCTACTTCCAGCAGTGTGACTAG |
| ORF Protein Sequence | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-532 | Pre-Made Spesolimab biosimilar, Whole mAb, Anti-IL36RN/IL-36R Antibody: Anti-FIL1/FIL1(DELTA)/FIL1D/IL1F5/IL1HY1/IL1L1/IL1RP3/IL36RA/PSORP/PSORS14 therapeutic antibody |
| Target Antibody | GM-Tg-g-SE0627-Ab | Anti-I36RA/ IL36RN/ FIL1 functional antibody |
| Target Antigen | GM-Tg-g-SE0627-Ag | IL36RN protein |
| Cytokine | cks-Tg-g-GM-SE0627 | interleukin 36 receptor antagonist (IL36RN) protein & antibody |
| ORF Viral Vector | pGMLP004790 | Human IL36RN Lentivirus plasmid |
| ORF Viral Vector | pGMLP-IL-042 | Human IL36RN Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-125 | Human IL36RN Adenovirus plasmid |
| ORF Viral Vector | vGMLP004790 | Human IL36RN Lentivirus particle |
| ORF Viral Vector | vGMLP-IL-042 | Human IL36RN Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-125 | Human IL36RN Adenovirus particle |
Target information
| Target ID | GM-SE0627 |
| Target Name | IL-36RN/IL36RN |
|
Gene Group Identifier (Target Gene ID in Homo species) |
26525 |
| Gene ID |
100065154 (Equus caballus), 26525 (Homo sapiens), 311783 (Rattus norvegicus), 518514 (Bos taurus) 54450 (Mus musculus), 611869 (Canis lupus familiaris), 705268 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL36RN,Il36rn,FIL1,FIL1D,IL1F5,IL1L1,PSORP,IL1HY1,IL1RP3,IL36RA,IL-36Ra,PSORS14,FIL1(DELTA),Il1f5,If36rn,Il-1h3,Il1hy1,Fil1delta |
| Target Alternative Names | FIL1,FIL1 delta,FIL1(DELTA),FIL1D,Fil1delta,IL-1-related protein 3 (IL-1RP3),IL-36RN,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,IL36RN,If36rn,Il-1h3,Il1f5,Il1hy1,Il36rn,Interleukin-1 HY1 (IL-1HY1),Interleukin-1 delta (IL-1 delta),Interleukin-1 family member 5 (IL-1F5),Interleukin-1 receptor antagonist homolog 1 (IL-1ra homolog 1),Interleukin-1-like protein 1 (IL-1L1),Interleukin-36 receptor antagonist protein,PSORP,PSORS14 |
| Uniprot Accession |
Q9QYY1,Q9UBH0
Additional SwissProt Accessions: Q9UBH0,Q9QYY1 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, INN Index, Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSECAG00000020486, ENSG00000136695, ENSBTAG00000039839, ENSMUSG00000026983, ENSCAFG00845011829, ENSMMUG00000061691 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


