Human OSCAR/PIgR-3/PIGR3 ORF/cDNA clone-Lentivirus particle (NM_206818)

Cat. No.: vGMLP004773

Pre-made Human OSCAR/PIgR-3/PIGR3 Lentiviral expression plasmid for OSCAR lentivirus packaging, OSCAR lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to OSCAR/PIgR-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004773 Human OSCAR Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004773
Gene Name OSCAR
Accession Number NM_206818
Gene ID 126014
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 861 bp
Gene Alias PIgR-3,PIGR3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCTGGTGCTGATCCTCCAGCTGCTGACCCTCTGGCCTCTGTGTCACACAGACATCACTCCGTCTGTGGCCATTATAGTCCCCCCAGCTTCATACCACCCTAAGCCATGGCTGGGAGCTCAGCCGGCTACAGTTGTGACCCCTGGGGTCAACGTGACCTTGAGATGCCGGGCACCCCAACCCGCTTGGAGATTTGGACTTTTCAAGCCTGGAGAGATCGCTCCCCTTCTCTTCCGGGATGTGTCCTCCGAGCTGGCAGAATTCTTTCTGGAGGAGGTGACTCCAGCCCAAGGGGGAAGTTACCGCTGCTGCTACCGAAGGCCAGACTGGGGGCCGGGTGTCTGGTCCCAGCCCAGCGATGTCCTGGAGCTGCTGGTGACAGAGGAGCTGCCGCGGCCGTCGCTGGTGGCGCTGCCCGGGCCGGTGGTGGGTCCTGGCGCCAACGTGAGCCTGCGCTGCGCGGGCCGCCTGCGGAACATGAGCTTCGTGCTGTACCGCGAGGGCGTGGCGGCCCCGCTGCAGTACCGCCACTCCGCGCAGCCCTGGGCCGACTTCACGCTGCTGGGCGCCCGCGCCCCCGGCACCTACAGCTGCTACTATCACACGCCCTCCGCGCCCTACGTGCTGTCGCAGCGCAGCGAGGTGCTGGTCATCAGCTGGGAAGGTGAGGGCCCTGAGGCCCGGCCCGCCTCCTCCGCCCCAGGAATGCAGGCCCCAGGACCTCCGCCCTCAGACCCAGGAGCCCAGGCCCCCAGCCTCTCCTCCTTCAGACCCAGGGGTCTAGTCCTGCAGCCCCTCCTCCCTCAGACCCAGGATTCCTGGGACCCAGCCCCTCCTCCCTCAGATCCAGGAGTCTAG
ORF Protein Sequence MALVLILQLLTLWPLCHTDITPSVAIIVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T81903-Ab Anti-OSCAR/ PIGR3/ PIgR-3 monoclonal antibody
    Target Antigen GM-Tg-g-T81903-Ag OSCAR VLP (virus-like particle)
    ORF Viral Vector pGMLP004773 Human OSCAR Lentivirus plasmid
    ORF Viral Vector vGMLP004773 Human OSCAR Lentivirus particle


    Target information

    Target ID GM-T81903
    Target Name OSCAR
    Gene Group Identifier
    （Target Gene ID in Homo species)         		126014
    Gene ID 100051988 (Equus caballus), 100336423 (Bos taurus), 105261216 (Felis catus), 106994857 (Macaca mulatta)
    126014 (Homo sapiens), 232790 (Mus musculus), 292537 (Rattus norvegicus), 484313 (Canis lupus familiaris)
    Gene Symbols & Synonyms OSCAR,Oscar,PIGR3,PIgR-3,mOSCAR,mOSCAR-M1,mOSCAR-M2,mOSCAR-M3,RGD1559897
    Target Alternative Names OSCAR,Osteoclast-associated immunoglobulin-like receptor,Osteoclast-associated receptor, hOSCAR,Polymeric immunoglobulin receptor 3 (PIgR-3, PIgR3, Poly-Ig receptor 3),PIGR3,PIgR-3
    Uniprot Accession Q8IYS5,Q8VBT3
    Additional SwissProt Accessions: Q8IYS5,Q8VBT3
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Osteoclast differentiation
    Gene Ensembl ENSECAG00000039917, ENSBTAG00000001051, ENSG00000170909, ENSMUSG00000054594
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.